SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4TJE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4TJE8
Domain Number 1 Region: 3214-3320
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-29
Family Cadherin 0.00061
Further Details:      
 
Domain Number 2 Region: 1013-1148
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-25
Family Cadherin 0.00079
Further Details:      
 
Domain Number 3 Region: 2702-2825
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 3733-3946
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-24
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 5 Region: 705-803
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 1979-2088
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 803-912
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-21
Family Cadherin 0.0022
Further Details:      
 
Domain Number 8 Region: 3115-3219
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 9 Region: 2189-2287
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-18
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 917-1024
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-18
Family Cadherin 0.0024
Further Details:      
 
Domain Number 11 Region: 2087-2194
Classification Level Classification E-value
Superfamily Cadherin-like 7e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 12 Region: 2494-2600
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-16
Family Cadherin 0.0036
Further Details:      
 
Domain Number 13 Region: 2401-2505
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000131
Family Cadherin 0.0071
Further Details:      
 
Domain Number 14 Region: 1446-1541
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000357
Family Cadherin 0.0033
Further Details:      
 
Domain Number 15 Region: 141-229
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000542
Family Cadherin 0.0022
Further Details:      
 
Domain Number 16 Region: 3316-3431
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000007
Family Cadherin 0.0028
Further Details:      
 
Domain Number 17 Region: 1130-1225
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000103
Family Cadherin 0.0026
Further Details:      
 
Domain Number 18 Region: 1639-1717,1745-1785
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000286
Family Cadherin 0.0032
Further Details:      
 
Domain Number 19 Region: 3012-3122
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000286
Family Cadherin 0.0017
Further Details:      
 
Domain Number 20 Region: 463-581
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.0078
Further Details:      
 
Domain Number 21 Region: 1773-1901
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000186
Family Cadherin 0.0061
Further Details:      
 
Domain Number 22 Region: 375-467
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000428
Family Cadherin 0.0069
Further Details:      
 
Domain Number 23 Region: 2605-2707
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000005
Family Cadherin 0.0073
Further Details:      
 
Domain Number 24 Region: 1888-1991
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000414
Family Cadherin 0.0015
Further Details:      
 
Domain Number 25 Region: 594-698
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000003
Family Cadherin 0.0057
Further Details:      
 
Domain Number 26 Region: 2806-2913
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000771
Family Cadherin 0.0083
Further Details:      
 
Domain Number 27 Region: 3951-3991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 28 Region: 2284-2389
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000271
Family Cadherin 0.0076
Further Details:      
 
Domain Number 29 Region: 4027-4068
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000124
Family EGF-type module 0.021
Further Details:      
 
Domain Number 30 Region: 3984-4024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family EGF-type module 0.018
Further Details:      
 
Domain Number 31 Region: 3428-3531
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000257
Family Cadherin 0.006
Further Details:      
 
Domain Number 32 Region: 1248-1321
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000514
Family Cadherin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N4TJE8
Sequence length 4476
Comment (tr|A0A0N4TJE8|A0A0N4TJE8_BRUPA) Uncharacterized protein {ECO:0000313|WBParaSite:BPAG_0000842201-mRNA-1} KW=Complete proteome; Reference proteome OX=6280 OS=Brugia pahangi (Filarial nematode worm). GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MASRRLLLLAPLLFSCGLVGSSWNYRREIDTFQFTAPVYNVSLEENARGKDIYAIVNEPI
RMGVPLPSDDAVLKFRIVEGDRQYFKAEVKTVGDFAFLLIRYRNDGILNRELKDRYEFLI
KASCRRKDATNLETTVMVNLFVRDQNDAGPIFEKDEYRTEVKQNVSPFTTILQVQASDAD
VALNSQIYYSLVEWSLDFMVDPISGAIRNLRLLESGTYELIVLAEDRASRLFRKKAHSDN
GNNLFNHNKAKAVIKVEPVERNKRKLSVEVKPISVSLWNVTQTVAIARIEGVAADVVTTL
EIVDGEYAGAFVLKKDSSSANVWLVETISGIWPQADWFIQLKATVVDDFVENLMENISIQ
LKGKRLVQYDDNLEVMQIVVNESVPLGYVLTQLKAHVINGIDGDNEQIRYSISNTDKPFS
VDENNGYLRVIKWLDYENVSSYRFEVSAKLLDSALEAKKAVEVIVADSNDHCPTFAVKWT
RGDPIALSRNYPINKVLFKAEALDIDSGANGRIRYELIGETVTIMRIFTVIPDSGEVVLQ
QKPPDNESQWKLRIRASDAGWPFPRSSEVLISIYISGTNPPPKTKPSFLRKPQNDHSPVF
MKQTVFVVSADTPPGKVVGRIESHDDDMGYAGLIRFGTFDKFFALEPFTGEVVLLAPLGE
LLRNKNKKKQMEYIVEISACDWGQPVRCTNGTVTFLITEANVYRPRFEKPYYRVHIAEDT
TIGTKFLAVLAQDNDYGDNGQVGYQIIDSQNHFQIDENTGVLQVMTKLDREEVAFHRLTI
MAFDHGHPMKVTFVNVTVVLTDINDNAPLCAEPIRKIIIPEDYPNNALLTCVAAWDPDEG
KNGKVAYTFDTTIETSLTLPFRIQEDTGCIFVNTDEPFDFETINRYNLSVEAMDNGEPML
SSICTVLVEFSDVNENLFPPLFDDIAREATVYENVPLWTEVFALKAVDPDSPEMPVKYTV
IDGDGISSFIIDSEGTLRTSIVLDREACDSYWLTIEACDMNPVPLCSVLHVFVRVLDIND
HIPLSIHPIYFSTIPENSPEDTVITKVEAEDKDDLLDRHDITNIRFKIVSGDPQSFFAID
TKTGYIVTRGKRRLDRETQKEHVIVVEICDQGHPKLCTTVSVVITITDLNDNLPLFKQTT
YNFNVPADKIGELCRVFAMDIDEGQNARILYNFTEADPRFSIDSDGQIITTDSLKENENY
QLTIKASDMGQPLQTSSPVLVTLNAVRRHTKKTANGKPKLLNENRWSRLSISDADSIGET
IGLIEAEDPDGDQLWWKITDGNPNNTFAISCDAGELYLAKSLDLIKKNITIVKLKFTVDD
GLDTTEGVVLIEISRKYRPEFDAHYHKILVPKTAPIGTVVHTLKATIEKLNDSISDRGII
FGIHVVEDIAVTDILRINPSSGEVVIAEPLNNIVTNFFIMVVYARFNQMINYAQLGISLF
DETKTPPKFVVSEYFTTISTSLPVGTPVLTVRAYDSDHSSIQYSIIEGNEDGHFAINEYS
GEIRTSQLISYNHERTTLIVQASIQKNSSLTDRCSVRINIFNDDLGRVNFPQPSYTLTVH
ESTPPNTIVYILKTNSVMSIRYSFRDPCPFLSVHPISGVISTKLVTSAASVPHTCIAIAR
NSLGTEDFMELKINVVSANQYAPYFSSTVYQGYIYENMPLNSSVLLEDGRQLLVKAIDHD
RGINGLVTYCIVSPLEPYFTIDYISGAILTKREIDFEKVGAFMNVFEELAKINVVDTRTI
RQMTDVKHWSFYVQASDSAPQVLTSPVPALVEIMVFDMNDEPPSFIQEYYNATLFLPTLK
NTTVCYVTAIDVDTVGILRYAIIASDDSQLFAIEEFTGRIYTSGNSSADYAKSDYEINLV
VSDGLKSDSAVLLVRTENTSETGSTIKFLATNYEAVITENMTSSIMVQLLTVCAISTVNG
SLLYSILNPSSYFIVGVTSGIISWTGTAIDREKIPVVKLIVQARLSNGANERAQSIVTIK
VEDKNDCEPRFIGLPYELTIPRDIKLADKVTNVKAVDADEGFNGAVRYKLKTSTEYFDIN
EYDGKIVISRSLEIANFDSVSLEVIAEDQGEPSLSSSAHVVIHIVDRNIPIFGNRYQEAH
ILESAAPGSLVTNVHAASIVGGRIGYAIKSGNDENRFRIDFDTGMINVHKPLDREKCTFY
NLTVVAIDVTRQGVRAESYVVVNVDDISDTPPHFTQLFYSISVSESAAIGTQLLQIEAID
PDIDDNHISYGITGPNASVLSVDPRSGVVSLMKSLDFETMRLFKFKLTASDSMQLTSETD
LLLHVTDANDIAPRFISKTFNSIVESETPINHFITKLDASDEDIMSNLEDGNRFLFSIID
GDVTLLQINQSTGVVSLLRAVAEDDLKIGKKHFNVSVSDGIFTDFCLLIVKIVRSPSEHQ
LPRFERMHYSAAVQENGPIGMSVMTVQAYNGIPPLRYSFNGCHENCSGILNIDETTGKVY
TRNLFDYEAQRIHQFVIMVTDAGDRCAFATLTLSVIDENDNIPQFISSKVETSVPVDSRP
GESVLMVFAFDYDVDDELEYSIVDSDEIRSKYFTIHPKQGLISVKELLNDLVGEQISLFV
RVTDSADPPHQSETSVILNVSPIAHLPKFSTQHFLFSVSEDVPIGTVVGRLQQDSQLELS
DVFFSLVSMDNLSDFPFSVKQESGQIVVNSVLDYEKTREIRFLVSLHSQRQLNAKAVSLV
TVRITDVNDNKPRFEITSERVVISEDLPIGSSITIIRAVDEDAVGLNSKVQYFLEEGNNS
STFKLDQETGWLSLFKEVDREVIEEYALIVNARDGGGQSTRKKITVVLKDVNDSPPQFSQ
ETYFIEQYMEDLRVGQDILQLQVHDPDLYPNNVTSLYIMRGNEHGIFGLEMNSLVLHKLP
TDSDSLESHLLILAHDGKYTATAEVMVKLLLNFSQFQCEPREILRNITEDSPTGTIIKMG
YQKVRKSLRFYLTGSESNLFAVENSGTVVVRDQLSSHISNQVELFLRAESPESLCIQRII
VKIERTSKGRVTFTQPVFYGMVRENRNATREERVFATRLETTIDGLDGIGSVTFKFANNS
NQYLDLFDIDSETGVIAAISSLDREVKDQYDFSVLAVSTAGNSAEAKVIIDVGDVNDNAP
VFEQNIYHLRIAEDEALGKELLQLKAYGGDDKEIINYQMQASDDVAKYLSIDANSGLLKL
ASLLDFEKLEKFMVTVIATDSGKPPLNSTCEIDVEILDVNDNPPLFVQHIYRATVLENMQ
RGTKVVQVLANDPDSEHFGRVSYSITNDAVGFTIEEDGWITTTEMLDREVKSTYRLIVKA
VDGGTPPLSDSTIVEIEVEDENDNAPVFKHCNMTAVVQESVEPGHVILPIFITDNDKEPN
TGPYRLEIIGDGASLFAFDRNLNLITTKRLPPHAKKEVYLLSVKVSDRDNLSTECPMTLF
VKEESRHAPQSNPLKITLNTLMGEFLGGIVGKIMATDEDSTDMLRYSLVDRETSANTIWS
NHQHSKIPFSIDSETGDIIGEADLLAGTYRFNVSVTDGKYIAVVPVVIDVISIDQDALDH
SVSVRIHNLLGETFFNKHVKNFMHSLSRFLNVKPQNVRILSVQSTLVRHHLLARQLNNKT
TSEQDLDILFTVSRADSRGYHRPNFIRQRLEDNVAQLSDDIGREIISVITEMCRRDVCAN
GECRDRLYLDDTHNVCYKTDRQSFSAPVHLRTYDCTCRTGYAGKRCDIPVDKCSRDQCTK
EEICVPMNTDIGFDCICPPGTTGDRCDATVCGRDRRECSQGAEIGVGGDGFFQITVANSV
ERRLELTIHFRTTSADAVIMYGAGNSDFHTIEVERRYIQYRWNCGTGPGVVRINQQTVSD
GKWHSLKVSRRSRHAKLVLDGLYEKEGDSPQGSDVVNLYRQDIRLTFGAMVTQSIDDSTF
TTANDLKPIVTKGMIGCFGRISVDGYEVSKTKQSLYLYNTRLNCDAIVSAPCAANPCKNE
GTCIPSSEKTYDCACPPRYSGSNCEIDLTPCVSRPCPRGVECINLHNDFYCSCPHGFTGK
TCQLRGDWDPCLSNPCGHFGSCIRLPHSATFICNCSHGYSGTACKDRITDLIADGWPLNA
IKIAGLIIVILLLIIFATLIICIYLRIKKSRKSPKVREMEYETNNYNPRVSMSYEGVSHA
GVTPAPPLFPRLHNSNYEKGLPTVQVRPLPIHERISSSSIGGASRSPSLAGSNRCRIRWI
AESGSIRNCGSERCTVSCDEIEPLASNEALRRYGEVIMGDDDEMASCSSSQLQLSVADRC
RRSSGPKYKTGMKRTRNIRASNEAQTKEDWRKQCEKRINEACDAAAELRGERLKSSAGIN
KNVTNDCSLNIKDDDDYMTMRPVHRRVIIQSSESQRRPLLETSDSDGMESADFSYPDEVK
PSQHRKPPPPPAHNIRRENSKAIVSSSDVPNRVYDEPAIDVGDKKSSKIVKKTQSTSELA
HSSERFDDFGNIDDSDDDRTVNTSTSSNVHQTMAVL
Download sequence
Identical sequences A0A0N4TJE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]