SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4UWI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4UWI5
Domain Number 1 Region: 582-684
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.96e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 435-506
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 145-214
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.97e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00034
Further Details:      
 
Domain Number 4 Region: 766-858
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000818
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 5 Region: 218-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 6 Region: 292-363
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 7 Region: 1072-1150
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000657
Family Eukaryotic type KH-domain (KH-domain type I) 0.00029
Further Details:      
 
Domain Number 8 Region: 714-786
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000701
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 9 Region: 1000-1076
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.00059
Further Details:      
 
Domain Number 10 Region: 500-577
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000482
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 11 Region: 346-431
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.00043
Further Details:      
 
Domain Number 12 Region: 856-946
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 13 Region: 953-994
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N4UWI5
Sequence length 1220
Comment (tr|A0A0N4UWI5|A0A0N4UWI5_ENTVE) Uncharacterized protein {ECO:0000313|WBParaSite:EVEC_0000185601-mRNA-1} KW=Complete proteome; Reference proteome OX=51028 OS=Enterobius vermicularis (Human pinworm). GN= OC=Oxyuroidea; Oxyuridae; Enterobius.
Sequence
MENGMNFKSENSSAPTDLPSEGGLNLAPGAERHQASLAQNGNPVGPSGINHTNNNELVLN
YSTDFPELPDSQTPDSEKILGGAWNKPPAVRSQIVTQVFQLHGDERASKFNANSFGSGSE
EEHRCKEIARATGQGKVEEARARLVRGLQTQVTREISVPKEHHRVLIGKEGSKLRQLEQE
TNCRIIVPGREMASDVIKVVGPREGVEKALHEIQLVSDKQSKLAQENLLIPRIYYPWIRG
PNNETVDALAAETGAKINIPPPAAQNEMIVITGEKEGVHRAAAAIKNIYEEKLANAKSVT
CQVPKPQHRYIIGPQRKGLTEILKETGVSVEVPPEEENSHTITLRGDQDKLGPALALVYA
KASSVITVEITCKPWMHKYLIGPKGTTLQTLVPNKDKVQIDFESGGVIILEGPPEYVKAA
QTALNDQIQHLEEEMALETIKVHPSFHRHVIGRGGSLITKIKEETGVQIIIPNEVTNSDE
IKVEGKKEGVKKAIEEITEIVKRIENEKSRDILIEQRLHKQIIGVKGEAIMKLREQYPTV
VFTFPDHGKKSNIINLRGDKNEVDKLYKHLSAIHKELLEHNYQMTVPIFKEFHKHIVGKG
GANVRKIREDTQTKIDLPGEDSREDKITVTGKKANVEKAVEQLTKIQNELASIVQKEVII
PQKVHSRLLGGGRRLIQDIQDECGGVVTIRGPKEDVANAEKLLLALAKDRELSSHEETVS
AKPEFHRFLIGRGGVKIKKLRESYPDVRISFPRETDTDKETIHLVGKKEETSKVKKLFEE
MINELSETVEIKFDVDPKFHRHFVIRGAAVLREIQDQNGGVTISFPRANSQDSKVTIKGY
KQCVESAKARIEEIVEDLQAQVKIEVEIPAVHHRALLSNRGQKIQELCAKFNVQLKFPDR
RLREEAAAAESQEKGDHEGPSPMDIITISGRDVRCQEAKEALLALVPVSKVMHEVNISIP
QQDKNSDEVTVTGTAENVEAAVKDILKRVEELEEAAEDRKRRSFKLEVNVPAEYHTRLIG
FGGNVVSDLRNRHNVQISFPDKDAVAMDKITLTGKCYEANCIACKEEIEAIINESQSLFA
QEISLDASFHPRLIGLKGRNVRKIMDEYQVEIRFPRSTDPDPNLVVVAGKDEDSVFDCID
RLRGMEEDYLQATGNFDRNERGQYLAQRLPEPAPPPKPVEVQIKGAPWQLDMQSDEQFPP
MGNSQTTGSVSGVWGGARRF
Download sequence
Identical sequences A0A0N4UWI5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]