SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N7E5Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N7E5Z2
Domain Number 1 Region: 1-265
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-49
Family Duffy binding domain 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N7E5Z2
Sequence length 450
Comment (tr|A0A0N7E5Z2|A0A0N7E5Z2_9APIC) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ALD49143.1} OX=647221 OS=Plasmodium gaboni. GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
VPPRRRQFCFTNIRTLYHKIKDENTFKEYLLHDAYNEAKELSGYYGNDHKKLLDAMKYSF
ADIGDIVKGKDMLYDGISENIQKIVDRINQTKTSSEQTITRETLWETNKTKVWNVMMCNY
KGDDKEEHCENYDTIDKTDQFLRWLTEWAQLFCKEKLTLAKTVVDECLQKLENDKATEIS
KIKDKECQQLLKKYKDWYVKRKPQWDDLQKAYKTYKKNNGSSGSQQLPSEADAQQYVTSK
CEKCDCNYSDLQKISEYQEKKKAQELLKELTKIAKTDSIDRINLLDAINNLVKNIKTKAP
IVANRLYPNAENAVQTILKNVLETTLEVAAQVYQTEKEIREEKKKKQEASQVPAPSQPPA
VGQGSGVPGGGGPAATPQVAAGGKAPLKASVPTGEPPSHSDLTSDILISTISPIGLTVAL
GSIALLYYLKVTKTYICIYVGIYTCGYIYM
Download sequence
Identical sequences A0A0N7E5Z2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]