SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8C3T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8C3T7
Domain Number 1 Region: 1056-1116
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000282
Family VWC domain 0.033
Further Details:      
 
Domain Number 2 Region: 77-145
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000188
Family VWC domain 0.033
Further Details:      
 
Domain Number 3 Region: 1166-1209
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000837
Family Fibronectin type I module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N8C3T7
Sequence length 1238
Comment (tr|A0A0N8C3T7|A0A0N8C3T7_9CRUS) von Willebrand factor (VWF) type C domain protein {ECO:0000313|EMBL:JAL34163.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MIGSTSSDSPTTIVEDHTSSPVEGGDSSATTGAPSSHHTVPQTAASTLETEAPPALTTTT
TGEDDSFTTPSSGTSAIPGEGSCLLNNVTYADGADVPVPSPCQQSCSCEASIIRCVIVEC
QEKPDHMPNCRPVFSPDKCCPHFECDDEQQVEPTTDQPTLTTQPEPESGSESSSSASTHA
PLTGTESSSGSQVASTDRPDASSSATEEGSGAEASEIVTEESLSTSAEPQETTELSGGES
TTTTTSQPIDVTEAQEESAPATDGAVDASSTSTSTPDASQSQTTDVSSGQESPETSTDST
ESTDSPAFSTDDTTTSSSAPASGSPSETSDKPEEVVATDATGVDGTESAPQVSSTADPSA
SVDPSAPTTPSQEIDSGSQVSVEATDAPDAGSESSPSPSPSSPESPSTESQSQSGTEGMD
FEIQTQPPATASPTIELGGPLTGAPSTDDDETVASTSSPSSTSAPETTDSSAEIDGSGSE
SGSESESESSGEPAVTVATPQEETSTTSTSELEASPSAEPAATTESSAPSESVSESGAGA
SLTDAPSGALTTSEPTATESDGSSSSASATTSSTETPPEPTDAEDSATTQSASVSTVGSE
ETGAPTTESAPLAVETGSTGVPSAATESQESTAPQAAGSTESTQAPLTESESQSVATAAP
ESTGSTAASQGPSDGSDSGEATTPESAETTHAPSSVSSTPSESESESESETEAEVVVTSS
GSTTESGATEESSQAAVVSSTQQAPSTDAESEATTPSAPSATEFTAAPTGSTPSSTSESA
ESAATEGASQSPSSVSSSSESAAPSATATTQDPSSATELSGSTSASESGPVGPGSEGESV
PSTSAGADGTTEASASQTGATDSVELTPSESESGAASEATQAPSVGSTRPPLTVGSGSGG
STRPPSTTAPTTAPTAAPTALPTAEPVTTSHPATATATATATAETAESSTTAVTVSEIPL
SASSMDSANLETSSGPTSAAPTAAPTALPTAEPVTTSHPATATATAETAESSTTAATVSE
IPLSASSMDSANLETSSGPTSPATPTDVEEADIAPGACLFDGKVYVSAQQIPRDDHCDFC
FCFRGDIICLQQSCPPPIPGCLEESIAGFCCPRYECPVRQVTHNVTWHSGDHRNNPSAFA
ALAGIPQGFNVELSDGVQDGDQVQVEGCEIKGEFYRFGELVGPASGPCLECRCGKGGMME
CDPRECQPEPTLRKVMALAATRRRRHVDAEGLVWIGGK
Download sequence
Identical sequences A0A0N8C3T7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]