SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N8T609 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N8T609
Domain Number 1 Region: 237-435
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.3e-24
Family Haloperoxidase 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N8T609
Sequence length 444
Comment (tr|A0A0N8T609|A0A0N8T609_PSESX) Uncharacterized protein {ECO:0000313|EMBL:KPY92680.1} KW=Complete proteome; Reference proteome OX=264459 OS=Pseudomonas syringae pv. spinaceae. GN=ALO94_03606 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
Sequence
MIRRSWRLLLAALAIVLFIVASGVWIWTRPAPPASLEHLDLEGGAPLTSVTPATTIKTRI
ALAVTAEEMLTDKQLLAISKDASARIIQVVLPKDDCVLQQKTFQAALQKLDGPAKVVGGI
GPGATLAWRWLAAQTDDKAQAISVGFELEQPSNPPPEVDEGDTPPPICDVPLPQKAQHGH
WQAAWNDAPDDPSAAFVRDQTNADTSISEHDIPLQQVLNTELRHLLLGENDGGGLGIPVV
ELPASQPSDTVTLFMSGDGGWRDLDKIVAGDMAKMGYPVVGIDVLRYYWDHKTPEQTAVD
LTDLMNHYRQKWGAKRFVLAGYSFGADVMPAIYNRLATDDQNRIDAIILLAFARTGSFEI
HVDGWLGNAGKEATTGQEMAKLPAAKVFCVYGIEEKKDSGCTDTTAVGEAVQLPGAHHFD
EDYPALAKRLIDAINKRQGKATAQ
Download sequence
Identical sequences A0A0N8T609
WP_057427190.1.62491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]