SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P0F2N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0P0F2N1
Domain Number - Region: 36-188
Classification Level Classification E-value
Superfamily Tropomyosin 0.015
Family Tropomyosin 0.0074
Further Details:      
 
Domain Number - Region: 561-685
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0471
Family YVTN repeat 0.037
Further Details:      
 
Domain Number - Region: 460-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0514
Family Xylanase/endoglucanase 11/12 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P0F2N1
Sequence length 1008
Comment (tr|A0A0P0F2N1|A0A0P0F2N1_BACT4) Chromosome partition protein Smc {ECO:0000313|EMBL:ALJ40789.1} KW=Complete proteome OX=818 OS=Bacteroides thetaiotaomicron. GN=Btheta7330_01220 OC=Bacteroides.
Sequence
MNKKFLSVILFGALMTVSTGTFVSCKDYDDDINNLQEQIDGQKNDLNSKITAVESSISSL
QTAQSSLQSEIAAAKDEASKAALAAQEAAIATAKAELEKVKAELQAADKADMATVDGKLA
EISGRIQTLEQFKTTTETTLAALSAADTNLQKSITTLQADVLANAEQIGRNKAAIEAQIA
ALEAYKGTNDDAIAGLKADLEKLQAGELTEAMVAKIAAQVTEVVGAKLELISAAFSKAVT
HVELCDYTFGGGNEDHIIAGASSRMDLRTTLAVEDRVFGKGSTDEVEAKAYTIANQKEFK
KGERAFLTDSVLIRVSPTNATLTEGQISFVNSALGNLDKLVTVEKVEQFKGTVTRGISAN
GLWKVVFKLNKENYTEENYLKAAKFDYKNGTAEDRLVKELKNIRYAVAVTDKPGDVERNV
TSGYDLFLGSDYEPQYQLTFKVNDKNVSALRNRFQQAEDQTYVADANKKLLYDYKWNVDN
GERVEKDGSYESIIDATYSSGTWRDQDLWWNGDNRNTKSFFSTKVGEKFTVELDGYDDDQ
ISGIYGFYVVLDEQRAVESAPSEIRAWNSYESDIKGLNTITTNSKIEMSIDTEKADGDII
GFRVYAVNHDGSLVDPDGKAFYVAVGDIDAMTTTLKADYIPVWDATAGDYKRVVEFALDE
EIQQMLVDKYNEGYSYSSLVVDKDNNPTATTAFIRRFNFDNDKVMNITLSNSLSQYKDNG
TYKMYFNILNKKKVVVKKVAIEITKKLPEFPAAFSAKANQFDAEGAKVVEVTDATWNSNP
VHNLGTAFNGISDPDNSIIDHNYTFTCSEKKIVFNSTLNDNRYGFKLDVNDKDAAADLFA
DKSAGKIYDINVSYIYNNVSSESVDNSYTVKAPAAKNFKLRLVCGEGFTSEWKNFDDKKN
PIKQVLKYTDRETKVKLADILKFKKGGVDYTSTFSADNIKECHLASNSVDDEYFTVTFDA
VNQEFVFTSKQSANPPTSDVTATLKFTMVDSFGHENAEEYPYFTIKEK
Download sequence
Identical sequences A0A0P0F2N1 Q8A6T4
gi|29347202|ref|NP_810705.1| 226186.BT_1792 NP_810705.1.73244 WP_011107983.1.97929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]