SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P0FFU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0FFU1
Domain Number 1 Region: 312-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000577
Family Clostridium neurotoxins, the second last domain 0.081
Further Details:      
 
Domain Number 2 Region: 101-276
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.000000000000229
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P0FFU1
Sequence length 590
Comment (tr|A0A0P0FFU1|A0A0P0FFU1_BACT4) Type I phosphodiesterase / nucleotide pyrophosphatase {ECO:0000313|EMBL:ALJ42633.1} KW=Complete proteome OX=818 OS=Bacteroides thetaiotaomicron. GN=Btheta7330_03097 OC=Bacteroides.
Sequence
MNKLLNILTYSLLVVCVLAFNYACTEYDTPAEIADDGTIDTGISTKIHRKVLWINIDGAV
GEVVKNSLPADGAIAKMLKNSKYSWTGVSDNRTLSVERNEDPVTWATMLTGVIPEKHSIT
DESYTANVEYNPNNPNEKVIHYQNIISYISNNDVNMLSLCVTPWAKLNKNMLNNAKTTIT
SENDVQTRDVVLNHIANEDYTFILADFSGMLEAGKSGGFKADNAAYVSALKTIDGYIGEF
LSAIDARENAFYEDWLIVVTSNHGGSADGRYGGTSEVERNTFGLFYYNHYTEKQLNGNRL
YGAYFDSQNEYKAVVFDSIGKYYSLGMDAFSMEIIMRMVPRQDGTYNGNNWDRILGKAGW
GLYRQRGTVSMRTNPKEGPALEQAITGYNDSKWHHYGVSISSAASGRRNWLITLDGKLQG
SGTTDTQGLAPDSSLLAIGGYSVPTSYYISEVRLWKKDLAEREFLQLSGEIDIEPSGDML
GYWKFKPTEQLEKLEEDTLVIKNQIQGGLNMYYIKDKTSSSPDIEQKASAMFANTLPTNV
NAERICVENTLIVPQILYWLGISVPSTLDGYVFINNYALSEEWREEVDTE
Download sequence
Identical sequences A0A0P0FFU1 C6IED0 Q8AB33
NP_809191.1.73244 WP_008766177.1.28290 WP_008766177.1.58123 WP_008766177.1.59346 WP_008766177.1.97929 226186.BT_0278 gi|29345688|ref|NP_809191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]