SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P0HIP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0HIP7
Domain Number 1 Region: 2-232
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-44
Family Duffy binding domain 0.000094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P0HIP7
Sequence length 310
Comment (tr|A0A0P0HIP7|A0A0P0HIP7_9APIC) Putative EMP1-like protein {ECO:0000313|EMBL:KYN93001.1} KW=Complete proteome OX=647221 OS=Plasmodium gaboni. GN=PGSY75_0039200 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DRDTFKEYLLHDAYNEGKQLWNLYSSDEQKALDAMKYSFADYGDIVKGDDMMNDLDRVQK
QLSSIFKQNGSVTGTESDNRKQWWEKNKQKVWNVMMCHYNGKEKTDTECPKHDDIDDDPQ
FLRWLTEWAQLFCYEKVDEAKTIVKQCIEKDKIQKATKISEIGDKKCQQLLKKYKHWYKS
RNQQWEGLKDAYKNYKTNNVSSGSGKLPSEADAEKYLKKKCPKCDCNYDDLQKISKYQNQ
QEQLLKELTKQAKYDTIDPKNTPLYKFLTLGGLAPTIIENAFKTTAGIIDKGIEYGPQAV
DIAKDVLKKL
Download sequence
Identical sequences A0A0P0HIP7
XP_018638709.1.24268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]