SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P1ALI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P1ALI0
Domain Number 1 Region: 17-97
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.09e-18
Family PAPS reductase-like 0.0014
Further Details:      
 
Domain Number 2 Region: 162-234
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000866
Family Thioltransferase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P1ALI0
Sequence length 244
Comment (tr|A0A0P1ALI0|A0A0P1ALI0_9STRA) Phosphoadenosine phosphosulfate reductase {ECO:0000313|EMBL:CEG41767.1} KW=Complete proteome; Reference proteome OX=4781 OS=Plasmopara halstedii. GN= OC=Plasmopara.
Sequence
MEALFGKLYEHETPEAHRQYGFMRKVEPMQRALKDLGAVVLLVGVRADQTEHRQQMKLVN
VYDGRLKICPILNWSKDKIEQYMTINQLEYHPLKALGYESVGDAHSSRPVTDADKGNDRA
GRFNGKHQECGLHLDMHDMKIEDLRFDNPLPKPEHKLLRLTKREKGITLFTKPTCKYCVA
AKDIIRERKWMFDEVSVPKDISLQLLQQIVGKPVQSVPQIFLDGQYIGGYAEFVTHLGIP
SHFN
Download sequence
Identical sequences A0A0P1ALI0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]