SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P4XV97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P4XV97
Domain Number 1 Region: 5-41,68-146
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000335
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 177-226
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000536
Family SOCS box-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P4XV97
Sequence length 264
Comment (tr|A0A0P4XV97|A0A0P4XV97_9CRUS) Ankyrin repeat and SOCS box protein 11 {ECO:0000313|EMBL:JAI85903.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MHRLKDDELAEMLIRAGADLNASDFYGHTPLWYAIWSTQLSRIKSPACMLPVSPRHCRVA
TKGQRPLLVAKLLAAGSRLGSTEDYSWSQCPLYLATKYLGYRGRHQLAMFLMAAGADPTR
MDSKGRSAIYWSLRNRDHDLFVFMIDSYNPRCWDSMLQRRGEELLTDLPDTHLKILQKQW
YNPPSLAKQCRLVIRLHLLQKFNYRSLFLLVPRLPLPTVIQRFLLVIKTLLNFRFYWVQP
VIKFFFFFCSWIKNYPMKKQPLAL
Download sequence
Identical sequences A0A0P4XV97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]