SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5B3Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5B3Z9
Domain Number 1 Region: 5-121
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000428
Family Ankyrin repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 151-200
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000432
Family SOCS box-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P5B3Z9
Sequence length 238
Comment (tr|A0A0P5B3Z9|A0A0P5B3Z9_9CRUS) Ankyrin repeat and SOCS box protein 11 {ECO:0000313|EMBL:JAJ33402.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MHRLKDDELAEMLTRAGADLNASDFYGHTPLWVATKGQRPLLVAKLLAAGSRLGSTEDYS
WSQCPLYLATKYLGYRGRHQLAMFLMAAGADPTRMDSKGRSAIYWSLRNRDHDLFVFMID
SYNPRCWDSMLQRRVEELLTDLPDTHLKILQKQWYNPPSLAKQCRLVIRLHLLQKFNYRS
LVLLVPRLPLPTVIQRFLLVIKTLLNFRFYWVQPVIKFFFFFCSWIKNYPMKKQPLAL
Download sequence
Identical sequences A0A0P5B3Z9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]