SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5SV04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5SV04
Domain Number 1 Region: 65-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 37-64
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000196
Family Somatomedin B domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P5SV04
Sequence length 326
Comment (tr|A0A0P5SV04|A0A0P5SV04_9CRUS) Somatomedin-B and thrombospondin type-1 domain-containing protein {ECO:0000313|EMBL:JAL61514.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
PAHSLGSCKEAGLCCTGRDASCVVQKTPQNAIIEDLRDTPCYCDHACLKLNDCCPDYRQT
CGVQDCQVSEWGPWSECDNQCGSGSQERTRVIAMEPSRGGKSCPPTLQKRGCQGTSQCGT
NKSTHHKAALKEMAMLLPASFGASRRMNDSHDIRKNLRFRNAELAQEHSEDSTNDYCVTF
ELTKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRNAELAQEHSEDSTNDYCVTFELTKV
SKACHKEKVFNSLLDGGVVCVRCEHRATRDYLGGRCGGHGVPGRITRWTSLTNVECHGKW
LRRPDESQEVSSSTCSCTEDALLIFV
Download sequence
Identical sequences A0A0P5SV04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]