SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5WXU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5WXU3
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily Globin-like 7.05e-56
Family Globins 0.00000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P5WXU3
Sequence length 147
Comment (tr|A0A0P5WXU3|A0A0P5WXU3_9CRUS) Hemoglobin subunit beta {ECO:0000313|EMBL:JAM23216.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFG
KEFTPEVQASWQKMVTGVASALSSRYH
Download sequence
Identical sequences A0A0P5WXU3 A0A2J8P6N7 D9YZU9 P61921 P62742 P69892
ENSP00000338082 ENSP00000369609 NP_000175.1.87134 NP_000175.1.92137 NP_001065247.2.37143 9598.ENSPTRP00000055104 9606.ENSP00000338082 gi|6715607|ref|NP_000175.1| ENSP00000338082 ENSP00000338082 ENSP00000369609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]