SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P5YNM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P5YNM0
Domain Number 1 Region: 76-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 48-75
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000126
Family Somatomedin B domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P5YNM0
Sequence length 290
Comment (tr|A0A0P5YNM0|A0A0P5YNM0_9CRUS) Somatomedin-B and thrombospondin type-1 domain-containing protein {ECO:0000313|EMBL:JAM47590.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
GKVILLLFLVRPAHSLGSCKEAGLCCTGRDASCVVQKTPQNAIIEDLRDTPCYCDHACLK
LNDCCPDYRQTCGVQDCQVSEWGPWSECDNQCGSGSQERTRVIAMEPSRGGKSCPPTLQK
RGCQGTSQCGTNKSTHHKAALKEMAMLLPASFGASRRMNDSHDIRKNLRFRNAELAQEHS
EDSTNDYCVTFELTKVSKACHKEKVFNSLLDGGVVCVRCEHRATRDYLGGRCGGHGVPGR
ITRWTSLTNVECHGKWLRRPDXXXXXXXXXXXXXXXXXXXXXXXXXRCAR
Download sequence
Identical sequences A0A0P5YNM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]