SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6CLE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6CLE1
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily PX domain 1.96e-16
Family PX domain 0.007
Further Details:      
 
Domain Number 2 Region: 203-401
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000453
Family BAR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P6CLE1
Sequence length 404
Comment (tr|A0A0P6CLE1|A0A0P6CLE1_9CRUS) Sorting nexin {ECO:0000256|PIRNR:PIRNR036924} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MAAVPELLEQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLSTFQS
PEFSVTRQHEDFVWLHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EMFGGFFKSVVKSADEVLFSGVKEVDDFFEQEKNFLINYYNRIKDSCAKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAETHQQECCQKFEQLSESAKEE
LINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
Download sequence
Identical sequences A0A0P6CLE1 Q9D8U8
NP_001186117.1.92730 NP_077187.1.92730 10090.ENSMUSP00000028909 ENSMUSP00000028909 ENSMUSP00000105657 ENSMUSP00000028909 mmt008001197.1 ENSMUSP00000028909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]