SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P6H4H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P6H4H2
Domain Number 1 Region: 112-232
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-34
Family cAMP-binding domain 0.00000211
Further Details:      
 
Domain Number 2 Region: 10-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 5.62e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00026
Further Details:      
 
Domain Number 3 Region: 236-302
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000458
Family cAMP-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P6H4H2
Sequence length 358
Comment (tr|A0A0P6H4H2|A0A0P6H4H2_9CRUS) cAMP-dependent protein kinase type I-beta regulatory subunit {ECO:0000313|EMBL:JAN57518.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MATNLDEEQSLRECEAYVARHNIQQILKDCIVQLCVVRPDNPTSFLREYFQKLEREAAKD
AKQKAALSPEDSEESPNAAQSGIMGVRPRRGGISSETVTEEDATNFIKKVVPKDFKTMDA
LAKAIAKNVLFSHLDENERPDILDAMFPVSAHSGEVIIQQGDEGDNFYVIDQGEVEVFVD
GNMVTVIGEGGSFGELALIYGTPRAATVKAKTDVKLWGLDRDSYRRILMGSTIRKRKMYE
EFLSKVSILESLEKWERYTVADALEPCGFEDGETIVRQGEPGDDFYIIVEGRAVVMQQRS
GGGSVDAXXXXXXXXXXXXXXSKWVIWAPPITLAKLPYCLIGRELPPLSPKDRSNVSN
Download sequence
Identical sequences A0A0P6H4H2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]