SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7TW06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7TW06
Domain Number 1 Region: 333-459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 420-552
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000115
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 3 Region: 255-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000261
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 175-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000035
Family EGF-type module 0.02
Further Details:      
 
Domain Number 5 Region: 295-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000655
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P7TW06
Sequence length 781
Comment (tr|A0A0P7TW06|A0A0P7TW06_9TELE) Multiple epidermal growth factor-like domains protein 6-like {ECO:0000313|EMBL:KPP61906.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_119946 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MRARAQQTEHRTLAVSIVSMIVSLVSVSGNRVRIHRTSVEQEMSFAAGPPAVLLATLVLL
VLPLAVAHVTMTTPNMTKAPQHQDQQQDQDAEDPKIQNLVMPNATESFGVTELVGVTVAS
TLATWPPDSATETPCPGNQVLSGERRGCGCPGQLVKRGENCTCPNGFKQQGTAECADLDE
CEGGPAGPCGPHADCSNTLGSFLCSCHHGYLKGQAGCEDIDECTLAAITGLQACTDVDEC
SFEERCHRELGNEYIDECGKTPDVCVGRGVCENTLGSYRCACPQGYRGNGTHCEDENECA
SGQHGCDTNARCGNIIGSYFCQCYQGFSGDGYSCFDVDECALSNGHCQHSCSNEPGAYRC
HCNPGYQITEDEHNCMDVDECAVQTGPCEQICTNTDGSFQCSCRPGYELHVDGYQCVDID
ECKLQRGGCSHGCTNTPGGHICHCPEPLLLDLDNTNCVNVTSCKLRNGGCDHVCTVRSEG
SVQCSCKAGWELGEDLRSCLDVDECSDFTNGGCEQLCINHPGAFNCSCMDGHEVRMDDPA
KCRPVCDPPCQNYGVCVAPNTCNCPAGYPGPGCSAICSPPCAHGGTCMRWNTCLCPPGWT
GLGCHSAICELPCANGGRCISPATCQCPSDYTGPQCLTPICTPPCLNGGRCVDVNKCACS
DVWQGARCRCSSGFTGNLCDEAVTTPCVPPCQHGATCGPHNKCICPEGTAGLRCEKLICP
VVTTVVSMARAVRKAVRESYVDRCGPLGVQLCTKYRVNQARVYLQAYRVGYKIQCPEKTR
R
Download sequence
Identical sequences A0A0P7TW06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]