SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P7Z3K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7Z3K5
Domain Number 1 Region: 29-102
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.22e-18
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 121-169
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000301
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P7Z3K5
Sequence length 238
Comment (tr|A0A0P7Z3K5|A0A0P7Z3K5_9TELE) Uncharacterized protein {ECO:0000313|EMBL:KPP75166.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_105610 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MSIKFFKISTWAQIVTSPHEQCFSSDKEEIDKKDYYGKTPLYWAAYKDQKASMQLLLNMH
GAGVDLPDSWGVTPMYLAACSGQVECIQLLVQAEAKIFYKKKKTGEAPKQLSFRPTLLTW
LENLVRQPHSLKHQCRQAVRRALGPARIQTLGSFALPLTLREYLMFQDLQIPNIVGQALG
IQGCDASRHPIAGHFAVPKVSLTACQICGPNRKHIYSQQVVQLLDEFRVVGENGIRIL
Download sequence
Identical sequences A0A0P7Z3K5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]