SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P8XUL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P8XUL9
Domain Number 1 Region: 372-594
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-53
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 67-185
Classification Level Classification E-value
Superfamily BRCT domain 1.6e-20
Family DNA topoisomerase II binding protein 1, TopBP1 0.06
Further Details:      
 
Domain Number 3 Region: 204-288
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000567
Family DNA topoisomerase II binding protein 1, TopBP1 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0P8XUL9
Sequence length 851
Comment (tr|A0A0P8XUL9|A0A0P8XUL9_DROAN) Uncharacterized protein, isoform B {ECO:0000313|EMBL:KPU78350.1} KW=Complete proteome; Reference proteome OX=7217 OS=Drosophila ananassae (Fruit fly). GN=Dana_GF24148 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
METIEEQSKCEMSISTTLASRICLVGEVGKDAETLLAAESFGLPIVTSDTGLDILGESEW
RTFYVLDDFEGASFEAIHKQKECILGPPALKYAAEMKQTLGQNSRPIYNYAMRGVVTCFT
GIRKKDELTKLVNLIHSMGGCIKKDLNTKTTHLICNHSGGEKYQYAKTFRLTVVRPAWVY
AAWSDRNSLEFDATQENFTKTHRLKAFEGQKICFFGFPPEEHQHMVDVLLENGGVCAELE
DPECSHVVVDEHTTVSKPEPKNNHTHILKSDWFWYTIQNGYANEMDYLFGDYLDSITNTP
NTDRRDSLPISFNKRKRKRFSQRIQLEGTPLGSGKRRSSVSDAGLLSVSNSFFDCTTSPD
KLEVDKLHHAEPEASDATPAKKSMRFNHFMDFFTTESNYVGILDTILNLFKNKLEELAET
NDPLLNKSEIKTIFGNFLPIHEVHQSMLEHLRKLHANWREDCLIGDIIIQHRDELIKAYP
PYVNFFEQMKEQLLYCDREYPRFHAFLKINQTKPECGRQSLQDLMIRPVQRLPSISLLLN
DILKHTNGSNADHGRLEEALKAIKQVTLHINEDKRRTESRMAIFDIFNDIDGCPPHLVSS
NRSFISKCEVNELSDSLSGRGDSLVVYLFSDSMELCKRRSRGFNTAKSPSTAKTHKHLKL
ISLNTIRLVIDISDSPRAFGLLQRGEKEKLYTFTISDEETDKHVYVKKLCNQIAAHTCRT
DADKLLISRTSQELEVDISDVNVSTLSKAFKLAAKTRLKVGRAFSFNKTPNKLKRAVSTM
MTSPFGSTNSLTPASQLAQMRLASCTNINEVDDEDCASMRSSSPSTQSEMLVVPPLSVQP
TRKNKAVVGRI
Download sequence
Identical sequences A0A0P8XUL9
XP_014764898.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]