SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9F070 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9F070
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.73e-19
Family Ubiquitin-related 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P9F070
Sequence length 60
Comment (tr|A0A0P9F070|A0A0P9F070_RHOGW) Uncharacterized protein {ECO:0000313|EMBL:KPV72874.1} KW=Complete proteome; Reference proteome OX=578459 OS=Rhodotorula graminis (strain WP1). GN=RHOBADRAFT_9880 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
VQSSDTVDHIKEMLVYAVNRSADQQRLIFDGKQLEDGRTLSDYNIQPYATLQLVFRAVGG
Download sequence
Identical sequences A0A0P9F070
XP_018268923.1.32311 jgi|Rhoba1_1|9880|gw1.13.293.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]