SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9GH11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9GH11
Domain Number 1 Region: 48-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.36e-26
Family APG12-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P9GH11
Sequence length 134
Comment (tr|A0A0P9GH11|A0A0P9GH11_RHOGW) Ubiquitin-like protein ATG12 {ECO:0000256|RuleBase:RU361201} KW=Complete proteome; Reference proteome OX=578459 OS=Rhodotorula graminis (strain WP1). GN=RHOBADRAFT_56019 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
MSALSPAVTPGPSPALGAPPPHLAQAAQGGKLSPRQALDATKQKDLTKVVVRFKATGNAP
IMKQNFYKITASNQFRTVIAFLRKELGWKPADSLFLYINSSFSPAPDDTVANLFKCFGTE
GHLIVNYSSTQAWG
Download sequence
Identical sequences A0A0P9GH11
jgi|Rhoba1_1|56019|estExt_Genemark1.C_160089 XP_018268245.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]