SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0P9HYI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9HYI1
Domain Number 1 Region: 42-305
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.16e-96
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000018
Further Details:      
 
Domain Number 2 Region: 309-605
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.36e-50
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P9HYI1
Sequence length 607
Comment (tr|A0A0P9HYI1|A0A0P9HYI1_9ARCH) Methyl-coenzyme M reductase I subunit alpha {ECO:0000313|EMBL:KPV61791.1} KW=Complete proteome; Reference proteome OX=1700836 OS=Candidatus Bathyarchaeota archaeon BA2. GN=AOA66_1761 OC=Archaea; Candidatus Bathyarchaeota.
Sequence
MEEKEERKKFYDDKGQITARERDYVRELYAVSKKFLPTERRRAIYSRLEKQFGADPLSLV
DSEMYKRGGYRQSKRKQEFVKSGRQIAIERGIPAYNRAVGIPLGQRILEPYVITGTDITV
EQDDTHHVNNPAIQQMVDDIKRTTIVNIDIAHRMLQVRAGKEVTPETINLYLETLNHTMC
GGAVAQEHMSEINPLLVKDAYAKVITGSDEIKDALDRRYVIDIDRLFHPTRAEQLKKALG
NSIWVVLRTPTIAIRMADGDEAHRWAAMQNTMAFIGSYGLSGEHVVSDLAYSFKHARVVN
MGNKMWYQRMRGRNEPGGFPDGYICDFIQSERDLPARPFLEVSEEDPEEAKKYSRAMYEG
IGAIAAVLDNMIWLGFYMSGGIGFSNTVSAAGLAGGVIEDITEELIETTHRYIRGIKKVP
PKWDIVRFIVDMIIQYVMESYEKFPALSEFHWGGAHKVSIIGSMGAGVASLLTGSSTMGM
WAGHYAIALVMKEGWLRTGWAGQEIQDHIGLPSLCSFRPEEGNFAELRGLNYPMQSFSAA
HGSLRDAAIYGAMIGRGSAWSASPVVKVAFADPHLVFDFKNPRLCIAKACIKQFMPAGER
GPSLPAH
Download sequence
Identical sequences A0A0P0KNW3 A0A0P9HYI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]