SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3LTT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3LTT7
Domain Number 1 Region: 608-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000381
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 417-546
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000151
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 710-836
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000526
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 642-683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000305
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 353-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000036
Family EGF-type module 0.007
Further Details:      
 
Domain Number 6 Region: 318-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000491
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 276-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 687-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3LTT7
Sequence length 1198
Comment (tr|A0A0Q3LTT7|A0A0Q3LTT7_AMAAE) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_163469 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MTRDRSVTLASGQFELEILSMQNANGELQNGNCCDGTRNPGDKKCTRDECDTYFKVCLKE
YQSRVTAGGPCSFGSKSTPVIGGNTFNLKYXRNNEKNRIVIPFSFAWPRSYTLLVEAWDY
NDNSTNPDRIIEKASHSGMINPSRQWQTLKHNAGAAHFEYQIRVTCAEHYYGFGCNKFCR
PRDDFFTHHTCDQNGNKTCLEGWMGPECNKAICRQGCSPKHGSCTIPGECRCQYGWQGQY
CDKCIPHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYCGTHPPCLNGGTCSNTGPDKYQ
CSCPEGYSGQNCEIAEXACLSDPCHNGGSCLETSLGFECVCAPGWAGPTCTDNIDDCSPN
PCGHGGTCQDLVDGFKCICPPQWTGKTCQLDANECEGKPCVNANSCRNLIGSYYCDCITG
WSGHNCDININDCRGQCQNGGSCRDLVNGYRCICSPGYAGDHCEKDINECASNPCMNGGH
CQDEINGFQCLCPAGFSGNLCQLDIDYCEPNPCQNGAQCFNLAMDYFCNCPEDYEGKNCS
HLKDHCRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCKSQAGGKFTCECNKGF
TGTYCHENINDCESNPCKNGGTCIDGINSYKCICSDGWEGTYCETNINDCSKNPCHNGGT
CRDLVNDFFCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCMCPAGWEGATCN
IARNSSCLPNPCHNGGTCVVSGESFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGD
NWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCICPPGRSGVGCQEVTGR
PCLTSVRVMPDGAKWDDDCNTCQCLNGKVTCSKVWCGPRPCVLHAKGXNECPAGHACVPV
REDHCFTHPCAAVGECWPSNQQPVKTKCNSDSYYQDNCANITFTFNKEMMAPGLTTEHXC
SELRNLNILKXVSVEYSIYITCEPSHLANNEIHVAISAEDIGEDENPIKDITDKIIDLVS
KRDGNNTLIAAVAEVRVQRRPVKNKTDFLVPLLSSVLTVAWICCLVTVFYWCIRKRRKQS
SHTHTASDDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENKNSKIAKIRTHNSEVEEDD
MDKHQQKARFAKQPAYTLVDRDEKPPNSTPTKHPNWTNKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences A0A0Q3LTT7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]