SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3U4Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3U4Y1
Domain Number 1 Region: 13-263
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-64
Family Ankyrin repeat 0.0000711
Further Details:      
 
Domain Number 2 Region: 304-351
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000746
Family SOCS box-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3U4Y1
Sequence length 390
Comment (tr|A0A0Q3U4Y1|A0A0Q3U4Y1_AMAAE) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KQL60854.1} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_04204 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MDFTEAYSDRCSAVGLAAREGNVKVLRKLIKQGYSIDVPDNRGWVPIHEAAARGSSECLR
LLVRAAPSDDYVNSKTFEGMSALHLAARCGSVESXRVLLEAGADPSDVTTERTTPLFLAV
ENGNTXAVTFLLQHGANVQGPHSLSGWNSLHQAALQECTEIMRMLLEKGAGKECKDDFGI
TPLFVAAQYGXLESLQLLISHGADVNCQAKDRATPLLIAAQEGHLECVRLLLANGADPNL
YCNEDNWQLPIHAAAEMGHDKILSVGDNALNFTLEFTNWKRLPPAVEQGLSEYKETFTWT
PKSHFASIPPLSHLCRLEIRAILRSERLRSDRFIRELPLPACLQDYLLYLDVLRVNGIPE
AEDYLGQREEGAAPSTEDAERRDTCATGTR
Download sequence
Identical sequences A0A0Q3U4Y1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]