SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q3U5L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3U5L0
Domain Number 1 Region: 526-895
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.79e-128
Family Hect, E3 ligase catalytic domain 0.00000000353
Further Details:      
 
Domain Number 2 Region: 20-155
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.99e-29
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 3 Region: 473-511
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000236
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 344-383
Classification Level Classification E-value
Superfamily WW domain 0.000000000000209
Family WW domain 0.0017
Further Details:      
 
Domain Number 5 Region: 186-226
Classification Level Classification E-value
Superfamily WW domain 0.00000000000138
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 420-456
Classification Level Classification E-value
Superfamily WW domain 0.0000000000025
Family WW domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3U5L0
Sequence length 902
Comment (tr|A0A0Q3U5L0|A0A0Q3U5L0_AMAAE) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_06211 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MAAAPVEVLGLPSEEENTRIVRVKIIAGIGLAKKDILGASDPYVKVTVYDPTSGVLTSVQ
TKTIKKSLNPKWNEELLFRVNPQKHRLLFEVFDENRLTRDDFLGQVDIPLYQLPTENPSM
ERPYTFKDFVLHPRSHKSRVKGHLRLKMTYLPKSNGSEEETTEQAEELEPGWIILDQPDA
AGQPQQQQQESPPLPSGWEERQDILGRTYYVNHEFRRTQWKRPTAQDNVAVADIGSVQLE
AQHVFTHRRQISEDTENLDNRDSPESWEIITEDEATMYSNQNLQIPLSQSNSDIQTHLAE
DLNTRLTTSGSSATGQSATYTNHSSRRGSLQTYRVEEQPAHPVLLPTSSGLPPGWEERQD
EKGRSYYIDHNSRTTTWVKPVVQTAVETGQLSATQSVSMGRPSQATSSDSSQQSSQQQPE
MEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKISAHPRRKTSLDPVDLGPLPPG
WEERTHTDGRIFFINHNTKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQSD
IPNRFEMKIHRTTILEDSYRRIIAVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSK
EMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIR
PFYKMMLQKPITLHDMESVDSEYYNSLRWILENDPTELDLRFVVDEELFGQTHQHELKSG
GSEIVVTNKNKRDYIHLVIQWRFVSRVQKQMSAFKEGFFELIPQDLIKIFDENELELLMC
GLGDVDVADWKLHTKYKNGYNINHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGF
AELYGSNGPQLFTVEQWGTPEKLPRAHTCFNRLDLPPYDSFEDLRDKLLLAIENTQGFDG
VD
Download sequence
Identical sequences A0A0Q3U5L0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]