SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q4EGX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q4EGX2
Domain Number 1 Region: 29-230
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000915
Family Haloalkane dehalogenase 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q4EGX2
Sequence length 233
Comment (tr|A0A0Q4EGX2|A0A0Q4EGX2_9SPHN) Type IV secretion system protein VirJ {ECO:0000313|EMBL:KQM47206.1} KW=Complete proteome OX=1735679 OS=Sphingomonas sp. Leaf208. GN=ASE69_14340 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MTWLYRSLLALVLAAIAAAGFMGWLGYFGGPLFTDVHPTKPQRPFAVVLLTGDLGYKIGM
APQIARRLAADGVPVVAVNTLTYLRTTRTPADITTLIARAEQRALRLGHTDRVVLIGQSF
GADMLHVGLVDLAPELRAKIAKVALIVPEDNVQFRASPSEVFDLWTPTVDAMPTARRLTW
APLLCVQGVEEVGSLCPLLTQANATRIALPGGHPLHRDADALYEVLARFVFAD
Download sequence
Identical sequences A0A0Q4EGX2
WP_056489680.1.93193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]