SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q4IGN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q4IGN9
Domain Number 1 Region: 29-230
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000348
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q4IGN9
Sequence length 233
Comment (tr|A0A0Q4IGN9|A0A0Q4IGN9_9SPHN) Type IV secretion system protein VirJ {ECO:0000313|EMBL:KQN01312.1} KW=Complete proteome OX=1735694 OS=Sphingomonas sp. Leaf230. GN=ASE82_15605 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MTWLYRSLLALLIAAIAAAGFMGWLGYFGGPLFTDVYPTKPQQPFAVVLLTGDLGYKIGM
APQIARRLAADGVPVVAVNTLTYLRTTRTPADITTLIARAEQRALRLGHTDRVVLIGQSF
GADMLHVGLVDLAPEVRAKIAKVALIVPEDNVQFRASPSEVFDLWTPTVDAMPTARQLTW
APLLCVQGVEEVGSLCPLLTQANATRIALPGGHPLHRDADALYEVLARFVFAD
Download sequence
Identical sequences A0A0Q4IGN9
WP_056065754.1.98745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]