SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q5GDZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q5GDZ9
Domain Number 1 Region: 216-280,311-365
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000785
Family SMI1/KNR4-like 0.015
Further Details:      
 
Domain Number 2 Region: 25-61,89-176
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000144
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q5GDZ9
Sequence length 372
Comment (tr|A0A0Q5GDZ9|A0A0Q5GDZ9_9XANT) Glucan biosynthesis protein {ECO:0000313|EMBL:KQQ79993.1} KW=Complete proteome OX=1736270 OS=Xanthomonas sp. Leaf131. GN=ASF73_02160 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MAALKWMVYGRSPSLDTFWDEALNLGRVPATEAAISGAQARLGVLLPAWLCELYARYDGG
AVQMARGHSLEEPGNWLKAEWLIPRARLLGSAELFSFAEVRAREEYRDDAYAGLAAGGDD
RRVIVIAADDRTPSRALCLDYSASDLEPTLVYVDAGTNRRLAVFANVDDLLSQLVDVHYW
SPALQAKHDGDVVDWQPQPPVLTTFWSGAGHWNDGGAAADATLLAATEARLGVRLPALFK
RLYSVQDGGDTRWCWVPRTRFPSDHYVDWECVLVDRYLLPLAKIGSVLDLAAAFEYPDDF
STAARLHAGLDQVLVLSCHNVDCLLCLDYRARGPQCEPDVVYFDRWEGLVPTWRAPSFDA
FFGVLRQAELGL
Download sequence
Identical sequences A0A0Q5GDZ9
WP_055824013.1.35545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]