SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q5IXD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q5IXD2
Domain Number 1 Region: 217-281,312-366
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000772
Family SMI1/KNR4-like 0.014
Further Details:      
 
Domain Number 2 Region: 26-61,89-176
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000144
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q5IXD2
Sequence length 373
Comment (tr|A0A0Q5IXD2|A0A0Q5IXD2_9XANT) Glucan biosynthesis protein {ECO:0000313|EMBL:KQR13360.1} KW=Complete proteome OX=1736275 OS=Xanthomonas sp. Leaf148. GN=ASF90_09225 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MAGLQWMVYGRSPSLDTFWDEALNLGRAPASEAAIAAAQARLEVHLPTWLRTLYARYDGG
AVQMARGQSLDEPDNWLKAEWLIPRARLLGSAELFSFAQVRAREDYRDDAFAGLAAGGDD
RRLIVIAADHRSPSRALCLDYSVPGAEPTLVYVDAGGNRRLIVFENVDALLSQLVDVVHW
SPALQAKHDENELVHWQPQPPALRTFWSGPGHWNDTAAAADAGALAAAEARLGVRLPALF
KRLYSVQDGGDTGWCWVPRTRFASAHYVDWECVLVDRYLSPLAQIGSLLDLAAAFEDPDD
FSAAACLHAGLDQVLVLSCHNIDCLLCLDYRARGPQGEPEVVYFEKWEGLVPTWRAPSFD
AFFSVLRQADLDF
Download sequence
Identical sequences A0A0Q5IXD2
WP_055849091.1.5326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]