SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q8JGS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q8JGS5
Domain Number 1 Region: 215-367
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000536
Family SMI1/KNR4-like 0.018
Further Details:      
 
Domain Number 2 Region: 32-65,93-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000249
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q8JGS5
Sequence length 369
Comment (tr|A0A0Q8JGS5|A0A0Q8JGS5_9GAMM) Glucan biosynthesis protein {ECO:0000313|EMBL:KRB10907.1} KW=Complete proteome OX=1736588 OS=Lysobacter sp. Root690. GN=ASD86_00125 OC=Xanthomonadaceae; Lysobacter.
Sequence
MSAGSSLQWMVYGRAPTLETFWDEELNLGRVAATDEAIAELEARLGIVLPAWLRTLYARY
NGGAVRMARGESIEQPGEWLKAEWLIPRARLLPLHEWFSFAQLRAREGYRDDAYAALAAD
DRRLIAIAIDEHNKTLCLDYSAGSEPMIVLTDQQRRLREYDDAAPWLADLVDLQYWNPAL
QARHDPAATLHWRPEPPGLDTFWSGPGFWDDASGAPAPADAIAAAETRLGVRLPALLRAL
YRRQDGGYTRFEWAPLRRHPSSHFYDWESVVPDRYLSSLAHLRTLADVASDFQDGAELWS
FARMHAHCERIVVLAMHGINWMLCLDYRERGPEHEPDVVYFEYFDELIPRYRARDFDCFF
ADLRQGELD
Download sequence
Identical sequences A0A0Q8JGS5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]