SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R0G8W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R0G8W1
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.51e-40
Family PAPS reductase-like 0.0034
Further Details:      
 
Domain Number 2 Region: 250-359
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.93e-22
Family PDI-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R0G8W1
Sequence length 362
Comment (tr|A0A0R0G8W1|A0A0R0G8W1_SOYBN) Uncharacterized protein {ECO:0000313|EMBL:KRH11445.1, ECO:0000313|EnsemblPlants:KRH11445} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_15G108700 OC=Phaseoleae; Glycine; Soja.
Sequence
MDKALEKFGNDIAIAFSGAEDVALIEYAHLTGRPYRVFSLDTGRLNPETYKFFDAVEKHY
GIHIEYMFPDAVEVQALVRTKGLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKD
QSPGTRSEIPIVQVDPVFEGLDGGIGSLVKWNPVANVNGLDIWNFLRTMNVPVNSLHSQG
YVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNLKQEDAAQLNGNGTSQGNGS
ATVADIFISQNVVSLSRSGIENLAKLENRKEHWLVVLYAPWCRFCQAMEESYVDLAEKLA
RSGVKVAKFRADGEQKEYAKSELQLGSFPTILLFPKHSSQPIKYPSEKRDVDSLTAFVNA
LR
Download sequence
Identical sequences A0A0R0G8W1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]