SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R2U2G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R2U2G9
Domain Number 1 Region: 7-65
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000117
Family 7-Fe ferredoxin 0.0000861
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R2U2G9
Sequence length 81
Comment (tr|A0A0R2U2G9|A0A0R2U2G9_9CYAN) PsaC {ECO:0000256|HAMAP-Rule:MF_01303} KW=Complete proteome; Reference proteome OX=1655601 OS=cyanobacterium BACL30 MAG-120619-bin27. GN=ABR96_03430 OC=Bacteria; Cyanobacteria.
Sequence
MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGDETSRSMGLSY
Download sequence
Identical sequences A0A0R2U2G9 A4CTH7 A5GI59 G4FMY2 Q0IDV2
32051.SynWH7803_0198 64471.sync_0133 gi|113955567|ref|YP_729370.1| gi|148238534|ref|YP_001223921.1| WP_006042515.1.44266 WP_006042515.1.57161 WP_006042515.1.60914 WP_006042515.1.65281 WP_006042515.1.66731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]