SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3PMQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3PMQ2
Domain Number 1 Region: 34-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 8-37
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000955
Family Somatomedin B domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R3PMQ2
Sequence length 210
Comment (tr|A0A0R3PMQ2|A0A0R3PMQ2_ANGCS) Uncharacterized protein {ECO:0000313|WBParaSite:ACOC_0000620401-mRNA-1} KW=Complete proteome; Reference proteome OX=334426 OS=Angiostrongylus costaricensis (Nematode worm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
MYLEAPPTSCYCDDSCTTLGDCCPDYAVVCPPQECVVSNWGEWEGCVADDGICGLGVEQR
VRHVTQQSARGGTPCPPLKEMRTCFKLCSKRRSLDDITTVALLLDYRHNETRSKKSRNNI
YWDMPSVYEKLKQTTSYCVKYKIGWVNRNCWHKQITMRLYRCASDLEDGEQGFWKLIGPK
SCNGIWTRISRDDNCHCGRNHTELDPFLLV
Download sequence
Identical sequences A0A0R3PMQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]