SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3REH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3REH0
Domain Number 1 Region: 3185-3291
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-28
Family Cadherin 0.00068
Further Details:      
 
Domain Number 2 Region: 1011-1145
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-25
Family Cadherin 0.0007
Further Details:      
 
Domain Number 3 Region: 2673-2796
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 3704-3917
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.03e-25
Family Laminin G-like module 0.0057
Further Details:      
 
Domain Number 5 Region: 703-801
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 1950-2059
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 796-915
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-21
Family Cadherin 0.0029
Further Details:      
 
Domain Number 8 Region: 1637-1756
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 3086-3190
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 2160-2258
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-18
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 911-1026
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-18
Family Cadherin 0.0029
Further Details:      
 
Domain Number 12 Region: 1122-1219
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-18
Family Cadherin 0.0014
Further Details:      
 
Domain Number 13 Region: 2058-2165
Classification Level Classification E-value
Superfamily Cadherin-like 7e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 14 Region: 1436-1567
Classification Level Classification E-value
Superfamily Cadherin-like 2.59e-16
Family Cadherin 0.0049
Further Details:      
 
Domain Number 15 Region: 2465-2570
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-16
Family Cadherin 0.0038
Further Details:      
 
Domain Number 16 Region: 2372-2476
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000111
Family Cadherin 0.0071
Further Details:      
 
Domain Number 17 Region: 139-227
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000005
Family Cadherin 0.0022
Further Details:      
 
Domain Number 18 Region: 3287-3403
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000642
Family Cadherin 0.0028
Further Details:      
 
Domain Number 19 Region: 2983-3093
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000728
Family Cadherin 0.0017
Further Details:      
 
Domain Number 20 Region: 461-579
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.0078
Further Details:      
 
Domain Number 21 Region: 1749-1845
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000228
Family Cadherin 0.0022
Further Details:      
 
Domain Number 22 Region: 373-465
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000443
Family Cadherin 0.0076
Further Details:      
 
Domain Number 23 Region: 2576-2678
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000585
Family Cadherin 0.0073
Further Details:      
 
Domain Number 24 Region: 1859-1962
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000443
Family Cadherin 0.0015
Further Details:      
 
Domain Number 25 Region: 592-696
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000186
Family Cadherin 0.0063
Further Details:      
 
Domain Number 26 Region: 2777-2906
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000443
Family Cadherin 0.0083
Further Details:      
 
Domain Number 27 Region: 3922-3962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000124
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 28 Region: 2260-2363
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000013
Family Cadherin 0.0045
Further Details:      
 
Domain Number 29 Region: 3998-4039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000124
Family EGF-type module 0.021
Further Details:      
 
Domain Number 30 Region: 3955-3995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000188
Family EGF-type module 0.018
Further Details:      
 
Domain Number 31 Region: 1245-1319
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000485
Family Cadherin 0.0075
Further Details:      
 
Domain Number 32 Region: 3399-3502
Classification Level Classification E-value
Superfamily Cadherin-like 0.00006
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3REH0
Sequence length 4447
Comment (tr|A0A0R3REH0|A0A0R3REH0_BRUMA) Bm3576, isoform a {ECO:0000313|WBParaSite:Bm3576a} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MASRRLLLLAPLLFSLVGSSWNYRRKIDTFQFTAPVYNVSLEENARGKDIYAIVNEPIRM
GVPLPSDDAVLKFRIVEGDRQYFKAEVKTVGDFAFLLIRYRNDGILNRELKDRYEFLIKA
SCRRKDATNLETTVMVNLFVRDQNDAGPIFEKDEYRTEVKQNVSPFTTILQVQASDADVA
LNSQIYYSLVEWSLDFMVDPISGAIRNLRLLESGTYELIVLAEDRASRLFRKKAHSDNGN
NLFNHNKAKAVITVEPVERNKRKLSVEVKPISVSLWNVTQTVAIARIEGVAADVVTTLEI
VDGEYAGAFVLKKDSSSANVWLVETISGIWPQADWFIQLKATAVDDFVENLMENISVQLK
GKRLVQYDDNLEVMQIVVNESVPLGYVLTQLKAHVVNGIDGDNEQIRYSISNTDKPFSVD
ENNGYLRVIKWLDYENVSSYRFEVSAKLLDSTLEAKKAVEVIVADSNDHCPTFAVKWTRG
DPIALSRNYPINKVLFKAEALDIDSGANGRIRYELIGETVTIMRIFTVIPDSGEVVLQQK
PPDNESQWKLRIRASDAGWPFPRSSEVLISIYISGTNPPPKTKPSFLRKPQNDHSPVFMK
QTVFVVSADTPPGKVVGRIESHDDDMGYAGLIRFGTFDKFFALEPFTGEVVLLAPLGELL
RNKNKKKQMEYIVEIIACDWGQPVRCTNGTVTFLITEANVYRPHFEKPYYRVHIAEDTTI
GTKFLAVLAQDNDYGDNGQVGYQIIDSQNHFQIDENTGVLQVMTKLDREEVAFHRLTIMA
FDHGHPMKVTFVNVTVVLTDINDNAPLCVEPIRKIIIPEDYPNNALLTCVAAWDPDEGKN
GKVAYTFDTIIETSLTLPFRIQEDTGCIFVNTDEPFDFETINRYNLSVEAMDNGEPMLSS
ICTVLVEFSDVNENLFPPLFDDIAREATVYENVPLWTEVFALKAVDPDSPEMPVKYTVID
GDGISSFIIDSEGILRTSIVLDREACDSYWLTIEACDMNPVPLCSVLHVFVRVLDINDHI
PLSIHPIYFSTIPENSPEDTVITKVEAEDKDDLSDRHDITNIRFKIVSGDPQSFFAIDSK
TGYIVTRGKRRLDRETQKEHVIVVEICDQGHPKLCTTVSVVITITDLNDNLPLFKQTTYN
FNVPADKIGELCRVFAMDIDEGQNARILYNFTEADPRFSIDSDGQIITTDSLKENENYQL
TIKASDMGQPLQTSSPVLVTLNAVRRHTKKTVNGKPKLLNENRWSRLSISDADSIGETIG
LIEAEDPDGDQLWWKITDGNPNNTFAISCDAGELYLAKSLDLIKKNITIVKLKFTVDDGL
DTTEGVVLIEISRKYRPEFDAHYHKILVPKTAPIGTVVHTLKATIEKLNDSISDRGIIFG
IHVVEDIAVTDILLINPSSGEVVIAEPLNNIVTNFFIIVVYARFNQMINYAQLGISLFDE
TKTPPKFVVSEYFTTISTSLPVGTPVLTVRAYDSDHSSIQYSIIEGNEDGHFAINEYSGE
IRTSQLISYNHERTTLIVQASIQKNSSLTDRCSVRINILNDDLGRVNFPQPSYSLTVHES
TPPNTIVYILKTNSVMSIRYSFRDPCPFLSVHPISGVISIKLVTSAASVPHTCIAIARNS
LGTEDFMELKINVVSENQYAPYFSSTVYQGYIYENMPLNSSVLLEDGRQLLVKAIDHDRG
INGLVTYCIVSPLEPYFTIDYISGAILTKREIDFEKVKHWSFYVQASDSAPQVLTSPVPA
LVEIMVFDMNDEPPSFIQEYYNATLFLPTLKNTTVCYVTAIDVDTVGILRYAIIASDDSQ
LFAIEEFTGRIYTSGNSSADYAKSDYEINLVVSDGLKSDSTVLLVRTENTSETGSTIKFL
ATNYEAVITENMTSSIMVQLLTVCAISTVNGSLLYSILNPSSYFIVGVTSGIISWTGTAI
DREKMPVVKLIVQARLSNGANERAQSIVTIKVEDKNDCEPRFIGLPYELTIPRDIKLADK
VTNVKAVDADEGFNGAVRYKLKTSTEYFDINEYDGKIVISRSLEIANFDSVSLEVIAEDQ
GEPSLSSSAHVVIHIVDRNIPIFGNRYQEAHILESAAPGSLVTNVHAASIVGGRIGYAIK
SGNDENRFRIDFDTGMINVHKPLDREKCTFYNLTVVAIDVTRQGVRAESYVVVNVDDISD
TPPHFTQFFYSISVSESAAIGTQLLQIEAIDPDINDNHISYGITGPNASVLSVDPRSGVI
SLMKSLDFETMRLFKFKLTASDSMQLTSETDLLLHVTDANDVAPRFISKTFNSVVESETP
INHFITKLDASDEDIMSNLGDGNRFLFSIIDGDVTLLQINQSTGVVSLLRAVAEDDLNIG
KKHFNVSVSDGIFTDFCLLIVKIVRSPSEHQLPRFERMHYSAAVQENGPIGMTVMTVQAY
NGIPPLRYSFNGCHENCSGILNIDETTGKVYTRNLFDYEAQRIHQFVIMVTDAGDRCAFA
TLTLSVIDENDNIPQFISSKVEISVPVDSRPGESVLMVFAFDYDVDDELEYSIVDSDEIR
SKYFTIHPKQGLISVKELLNDLVGEQISLFVRVTDSADPPHQNETSVILNVSPIVHLPKF
STQHFLFSVSEDVPIGTVVGRLQQDSQLELSDVFFSLVSMDNLSDFPFSVKQESGQIVVN
SVLDYEKTREIRFLVSLHSQRQLNAKAVSLVTVRITDVNDNKPRFEITSERVVISEDLPI
GSSITIIRAVDEDAVGLNSKVQYFLEEGNNSSTFKLDQETGWLSLFKEVDREVIEEYALI
VNARDGGGQSTRKKITVVLKDVNDSPPQFSQETYFIEQYMEDLRVGQDILQLQVHDPDLY
PNNVTSLYIMRGNEHGIFGLEMNSLVLHKLPTDSDSLESHLLILAHDGKYTATAEVVVKL
LSNFSQFQCEPREILRNITEDSPTGTIIKMGYQKVRKSLRFYLTGSESNLFAVENSGTVV
VRDQLSSHISNQVELFLRAESPESLCIQRIIVKIERTSKGRVTFTQPVFYGMVRENRNAT
KEEKVFATRLETTIDDLDGIGSVTFKFANNSNQYLDLFDIDSETGVIAAISSLDREIKDQ
YDFSVLAVSTAGNSAEAKVIIDVGDVNDNAPVFEQNIYHLRIAEDEALGKELLQLKAYGG
DDKEIISYQMQASDDVAKYLSIDANSGLLKLASVLDFEKLEKFMVSVIATDSGKPPLNST
CEIDVEILDVNDNPPLFMQHIYRAMVLENMQRGTKVVQVLANDPDSEHFGRVSYSITNDA
VGFTIEEDGWITTTEMLDREVKSTYRLIVKAVDGGTPPLSDSTIVEIEVEDENDNAPVFK
HCNMTAVVQESVEPGHVILPIFITDNDKEPNTGPYRLEIIGDGASLFAFDRNLNLITTKR
LPPHAKKEVYLLSVKVSDRDNLSTECPMTLFVKEESRHAPQSNPLKITLNTLMGEFLGGI
VGKIMATDEDSTDMLRYSLADREASANTIWSNHQHSKIPFSIDSETGDIIGEADLLAGTY
RFNVSVTDGKYIAVVPVVIDVISIDQDALDHSVSVRIHNLLGETFFNKHVKNFMHSLSRF
LNVKPQNVRILSVQSTLVRHHLLARQLNNKTTSEQDLDILFTVSRADSRGYHRPNFIRQR
LEDNVAQLSDDIGREIISIITEMCRRDVCANGECRDRLYLDDTHNVCYKTDRQSFSAPVH
LRTYDCTCRTGYAGKRCDIPVDKCSRDQCTKEEICVPMNTDIGFDCICPPGTTGDRCDAT
VCGRDRRECSQGAEIGVGGDGFFQITVANSVERRLELTIYFRTTSADAVIMYGAGNSDFH
TIEVERRYVQYRWNCGTGPGVVRINQQTVSDGKWHSLKVSRRSRHAKLVLDGLYEKEGDS
PQGSDVVNLYRQDIRLTFGAMVTQSVDDSTFTTANDLKPIVTKGMIGCFGRISVDGYEVS
KTKQSLYLYNTRLNCNAIVSAPCAANPCKNEGTCIPSSEKAYECACPPRYSGSNCEIDLT
PCVSRPCPRGVECINLHNDFYCSCPHGFTGKTCQLRGDWDPCLSNPCGHFGSCIRLPHSA
TFICNCSHGYSGTACKDRITDLIADGWPLNAIKIAGLIIVILLLIIFATLIICIYLRIKK
SRKSPKVREMEYETNNYNPRVSMSYEGVSHAGVTPAPPLFPRLHNSNYEKGLPTVQVRPL
PIHERISSSSIGGASRSPSLAGSNRCRIRWIAESGSIRNCGSERCIVSCDEIEPLASNET
LRRYGEVIMGDDDEMASCSSSQLQLSVADRCRRSSGPRYKTGMKRTRYIRASNEAQTKED
WRKQCEKRINEACDAAAELRGERLKSSAGINKNVTNDCSLNIKDDDDYMTMQPVHRRVII
QSSESQRRPLLETSDSDGMESADFSYPDEVKPSQHRKPPPPPAHNIKRKNSKAIVSSSDV
PNRVYDEPAIDVGDKKSSKIVKKTQSTSELAHSLERFEDFGNIDDSDDDRTVNTSTSSNV
HQTMAVL
Download sequence
Identical sequences A0A0R3REH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]