SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R4IDE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R4IDE6
Domain Number 1 Region: 535-785
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.29e-74
Family Hect, E3 ligase catalytic domain 0.000000302
Further Details:      
 
Domain Number 2 Region: 22-157
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-29
Family PLC-like (P variant) 0.07
Further Details:      
 
Domain Number 3 Region: 479-518
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000034
Family WW domain 0.00023
Further Details:      
 
Domain Number 4 Region: 184-227
Classification Level Classification E-value
Superfamily WW domain 0.000000000000139
Family WW domain 0.0013
Further Details:      
 
Domain Number 5 Region: 341-382
Classification Level Classification E-value
Superfamily WW domain 0.000000000000264
Family WW domain 0.0012
Further Details:      
 
Domain Number 6 Region: 428-468
Classification Level Classification E-value
Superfamily WW domain 0.0000000000178
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R4IDE6
Sequence length 787
Comment (tr|A0A0R4IDE6|A0A0R4IDE6_DANRE) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=nedd4a OC=Cyprinidae; Danio.
Sequence
MNMAAQLPEVRGLQTDEDESRILRVKIIAGIGLAKKDILGASDPYTRISLYDPVNGEITS
LQTKTIKKTLDPKWNEEFFFRVHPRRHRLLLEVFDENRLTRDDFLGQVDVPLHQIPTEHP
NNERPYTFKDFLLHPRSHKSRVKGHLRLKMTYLPKNSDAEDDPAEQGENLDPGWEFLEPH
ELCSPHHPHQLPALPPGWEERQDNLGRTYYVNHESRTTQWHRPTIQDSQRDNEQRQETHS
ESQRAFLTRRQISEHEENHERRESPESWEIITADESTLYSSLSERSPPPPHSPMEISTFC
EEFNRLQATNDRRTSLTPQGHGSRRGSGQTLTMEEHPVHPVLLPTSAGLPPGWEEKQDSK
GRIYFVNHNSRTTTWTRPLIQLIQPPSESPASPMASGSTSLSQNAAGYALPPDVSPQHTH
THTHTHTPEHPGLMPTGWEVRSAPSGRPFFIDHNTKTTTWDDPRLKVPVQMRRRVSLDPT
DLGPLPPGWEERVHSDGRIFYIDHNTKTTQWEDPRLQNSAITGPAVPYSRDYKQKYEYFR
KKLKKPAEIPNRFELSVRRNAVLEDSYRRILSVKRSELLKARLWVEFEGEKGLDYGGVAR
EWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGK
LLDAFFIRPFYKMMLQKPITLQDMESVDSEYFNSLRWILENDPTDLDLRFTIDEELFGQT
HQHELKPGGADIVVNDTNKKEYIHLVMQWRFVDRIQRQMTAFKEGFYELIPQDLIKIFDE
NELEVGF
Download sequence
Identical sequences A0A0R4IDE6
ENSDARP00000058160 ENSDARP00000058160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]