SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R4IJB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R4IJB4
Domain Number 1 Region: 647-959
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-91
Family Protein kinases, catalytic subunit 0.0000000486
Further Details:      
 
Domain Number 2 Region: 122-199
Classification Level Classification E-value
Superfamily HR1 repeat 3.14e-25
Family HR1 repeat 0.0000881
Further Details:      
 
Domain Number 3 Region: 207-284
Classification Level Classification E-value
Superfamily HR1 repeat 8.5e-24
Family HR1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 19-97
Classification Level Classification E-value
Superfamily HR1 repeat 9.02e-21
Family HR1 repeat 0.00032
Further Details:      
 
Domain Number 5 Region: 385-475
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000139
Family PLC-like (P variant) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R4IJB4
Sequence length 977
Comment (tr|A0A0R4IJB4|A0A0R4IJB4_DANRE) Zgc:153916 {ECO:0000313|Ensembl:ENSDARP00000133716} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zgc:153916 OC=Cyprinidae; Danio.
Sequence
MAADSVQNDARGPMVSGRLDFDQNLDFSDTMVQKNLDEIKDQIKREIRKELKIKEGAENL
RKVTTDKKSLAYVDNMLKKSNKKVEELHQELQELNAHIVVKDPEEVVEYPLTPDTPKSET
RMSTNSNRLAALKKQADIELKVKQGAENMIQMYSNGSSKDRKLLAAAQQMLQDSKTKIEF
IRMQILKASQTSEINYENNDVTTSKPIISPLDLRIEELRHHYRIESAVADGAKNVMKLLG
TGKVTEKKAHSEAQARLNESSQKLDLLKFSLEQRLSELPKNHPKGTLIMEELAMVASPPN
SPRQSIMSTSNQYSTVAKPAALTGTLDVRLMGCQDLLENVPGRSKTASVSLPGWSPSEAR
SSFMSRGNKNKSGSSRTLSKSDDLSNEISAVLKLDNTVVGQTHWKPVSNQSWDQKFTLEL
DRSRELEIAVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFNPVIER
RPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPSVNTSFSPQAADLGSAMSH
ETAPMGHPDAHSLPSDPTVTKLDFDKAVTPPSKRNSIEVEIEETAPPDKISDGKEVQDAL
ATFDFLNNTVAKPDYDSLVEHEQPGLELTEIQRKTEIREEEEVQFSLSDFKCVAVLGRGH
FGKVLLADYKTTGEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACF
QTKEHVCFVMEYAAGGDLMMHIHADVFSETRSVFYAACVVLGLQFLHDHKIVYRDLKLDN
LLLDTEGYVKIADFGLCKEGMGFKDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLI
FEMLVGESPFPGDDEEEVFDSIVNDEVRYPKYLSTEAISIMRRLLRRNPERRLGAGERDA
EEVKRHPFFRDMDWPGLLAKKIRPPFVPTITSREDVSNFDDEFTSEAPILTPPREPRILT
LGEQDLFADFDYIADWC
Download sequence
Identical sequences A0A0R4IJB4
ENSDARP00000100346 ENSDARP00000100346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]