SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R4ISE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R4ISE2
Domain Number 1 Region: 362-547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.92e-68
Family SPRY domain 0.00000298
Further Details:      
 
Domain Number 2 Region: 27-100
Classification Level Classification E-value
Superfamily RING/U-box 1.94e-20
Family RING finger domain, C3HC4 0.0044
Further Details:      
 
Domain Number 3 Region: 149-215
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.02e-17
Family B-box zinc-binding domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R4ISE2
Sequence length 551
Comment (tr|A0A0R4ISE2|A0A0R4ISE2_DANRE) Bloodthirsty-related gene family, member 22 {ECO:0000313|Ensembl:ENSDARP00000139519} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=btr22 OC=Cyprinidae; Danio.
Sequence
MAESTNGKAAKRRSIDEPPLMSFSSGPLSEELQCSICLEVFTDPVSTPCGHNFCKSCLNK
CWNNSKTCSCPNCKETFTQRPDLKINTTLREISEHYKEKKPEEKAEVVCDVCEDRKLKAL
KSCLVCQISYCQTHLEPHLRVAGLKKHKLMDPVRNLEDYICQNHDRPLELFCRDDQTCVC
PMCDLTEHKNHKTVPIEEESKEKKTQLMKTQKDVQQMIQDRVKKIQDVKHSSGVRKINSE
KEKAAREELFTDLIRSIERCQTEQLKMVEEQQKAAEKQEEELIEELEQEITELKMRNTEL
EQLSHTEDHLHLLQSYSSLQRPTDTRNWNEISLKTHNSLEALRKALDQLKDTVEEKFSQT
ELKLMQQYAVDVTLDPDTANPYLILSDDGKQVRCGDIEQELPDKPQRFDKYEDVLGKEGF
SSGRFYYEVQVKKKTDWTLGVVRESVDRKGEITLSPGNGYWTVWLRNGNEYKFCADSPVS
LSLKVKPQRVGVFVDYEEGLVSFYDVESSSHIYSYTGQTFTDKLYPYFSPEDNDDGKNSA
PLIITPVNYNK
Download sequence
Identical sequences A0A0R4ISE2
ENSDARP00000115426 ENSDARP00000115426 XP_005173784.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]