SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R4IVP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R4IVP0
Domain Number 1 Region: 201-439
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-72
Family Nuclear receptor ligand-binding domain 0.00000000679
Further Details:      
 
Domain Number 2 Region: 91-177
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-28
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R4IVP0
Sequence length 441
Comment (tr|A0A0R4IVP0|A0A0R4IVP0_DANRE) Nuclear receptor subfamily 1, group H, member 3 {ECO:0000313|Ensembl:ENSDARP00000139970} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=nr1h3 OC=Cyprinidae; Danio.
Sequence
MSTLSATDITDVGHGDSLGCDSEEGPSAAMAEVKQEILSQTDLYNTSHDDLNDSMLMESN
DIKMFFREDKAAPEGQPVKRKKGPAPKMLGNEVCSVCGDKASGFHYNVLSCEGCKGFFRR
SVIKGAQYSCKNSGRCEMDMYMRRKCQQCRLRKCREAGMLEQCVLSEEQIRLKKMKKQEE
ETARTSTVATPSPAPEMPPLAPEQQEMIEKLVAMQKQCNKRSFIDRPKVTPWPQSQDPQN
REVRQQRFAHFTELAIMSVQEIVDFAKQLPGFLELTREDQIALLKTSTIEIMLLETSRRY
NPAIDSITFLKDFTYNKEDFAKAGLQLEFINPIFEFSKGMNDLHLDEAEYALLIAINIFS
ADRPNVQDHELVERLQQPYVDALHSYIRIKRPNDHLMFPRMLMKLVSLRTLSSVHSEQVF
ALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences A0A0R4IVP0
ENSDARP00000108778 NP_001017545.2.45394 ENSDARP00000108778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]