SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R4IYT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R4IYT6
Domain Number 1 Region: 57-203
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0086
Further Details:      
 
Domain Number 2 Region: 184-298
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000288
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R4IYT6
Sequence length 399
Comment (tr|A0A0R4IYT6|A0A0R4IYT6_DANRE) Zgc:63863 {ECO:0000313|Ensembl:ENSDARP00000141258} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zgc:63863 OC=Cyprinidae; Danio.
Sequence
MKKAKKRLPASGSRASVGRHEENLPWKKKKLLDIHQALNSDPVDIETLRQAAVSEGGLLT
DDIRRKVWPKLLNINVYSLPAKPSKDVREDHKDYRQVVLDVRRSMRRFPKGMRVDEREVL
QEQLIDIILDVLRRNPQLHYYQGYHDIVVTFLLVLGERMTIAIMEKLSNHHLRDFMDPTM
DSTKHILNYLMPLLERVDRELHDFMIRSEVGTIFALSWLITWYGYVLSDFRHVLRLYDFF
LASHPLMAIYFAAVIVLYRQKEVKSSECDMASVHHLLSRMPQDLPYEDLIGRAQSLFSSC
PPSQMSRSAALQSRNILAISTFTDFQTSTRTQRPDSVLRQQIQNRQENQLALPMMPQPTG
TNQLIKMAVWGLSATLGAAALAVAQTALDWAPEFLSQLF
Download sequence
Identical sequences A0A0R4IYT6
ENSDARP00000057262 7955.ENSDARP00000057262 ENSDARP00000057262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]