SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R4J1R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R4J1R8
Domain Number 1 Region: 147-382
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-61
Family Nuclear receptor ligand-binding domain 0.000000000841
Further Details:      
 
Domain Number 2 Region: 52-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-27
Family Nuclear receptor 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R4J1R8
Sequence length 413
Comment (tr|A0A0R4J1R8|A0A0R4J1R8_MOUSE) Thyroid hormone receptor alpha {ECO:0000313|Ensembl:ENSMUSP00000115323} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Thra OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKGPQVRQLEQQLGEAGSLRGPVLQHQSPKSPQQRLLELLHRSGI
Download sequence
Identical sequences A0A0R4J1R8
ENSMUSP00000115323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]