SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0S2Z4F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S2Z4F1
Domain Number 1 Region: 212-334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.22e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 170-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000182
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  A0A0S2Z4F1
Domain Number - Region: 333-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00042
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000742
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S2Z4F1
Sequence length 493
Comment (tr|A0A0S2Z4F1|A0A0S2Z4F1_HUMAN) EGF containing fibulin-like extracellular matrix protein 1 isoform 1 {ECO:0000313|EMBL:ALQ33516.1} OX=9606 OS=Homo sapiens (Human). GN=EFEMP1 OC=Catarrhini; Hominidae; Homo.
Sequence
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVA
SAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAG
THNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCS
PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT
SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRCY
PRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA
NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
VLRLTIIVGPFSF
Download sequence
Identical sequences A0A0S2Z4F1 H2REY4 Q12805
9598.ENSPTRP00000020509 9606.ENSP00000347596 gi|86788015|ref|NP_001034437.1| gi|86788132|ref|NP_001034438.1| ENSP00000347596 ENSP00000378057 ENSP00000378058 ENSP00000347596 ENSP00000378058 ENSPTRP00000060075 ENSP00000347596 NP_001034437.1.87134 NP_001034437.1.92137 NP_001034438.1.87134 NP_001034438.1.92137 XP_016804050.1.37143 XP_016804051.1.37143 XP_016804052.1.37143 ENSPTRP00000060075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]