SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0S2Z4K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S2Z4K3
Domain Number 1 Region: 266-455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-35
Family Laminin G-like module 0.00000416
Further Details:      
 
Domain Number 2 Region: 468-669
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-28
Family Laminin G-like module 0.0000384
Further Details:      
 
Domain Number 3 Region: 41-93
Classification Level Classification E-value
Superfamily GLA-domain 2.52e-20
Family GLA-domain 0.00039
Further Details:      
 
Domain Number 4 Region: 120-248
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  A0A0S2Z4K3
Domain Number - Region: 241-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000402
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S2Z4K3
Sequence length 676
Comment (tr|A0A0S2Z4K3|A0A0S2Z4K3_HUMAN) Protein S isoform 1 {ECO:0000313|EMBL:ALQ33741.1} OX=9606 OS=Homo sapiens (Human). GN=PROS1 OC=Catarrhini; Hominidae; Homo.
Sequence
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIE
ELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQ
CSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPG
SYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKS
CEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIE
VQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL
LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVE
KGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLV
DSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL
QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHND
IRAHSCPSVWKKTKNS
Download sequence
Identical sequences A0A0S2Z4K3 P07225
ENSP00000330021 ENSP00000377783 NP_000304.2.87134 NP_000304.2.92137 9606.ENSP00000377783 gi|192447438|ref|NP_000304.2| ENSP00000377783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]