SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S4IKZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S4IKZ9
Domain Number 1 Region: 141-261
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000278
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 53-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000036
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 7-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000759
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S4IKZ9
Sequence length 276
Comment (tr|A0A0S4IKZ9|A0A0S4IKZ9_BODSA) Glutathione S-transferase, putative {ECO:0000313|EMBL:CUE69977.1} KW=Complete proteome; Reference proteome OX=75058 OS=Bodo saltans (Flagellated protozoan). GN=BSAL_52250 OC=Eukaryota; Euglenozoa; Kinetoplastida; Bodonidae; Bodo.
Sequence
MSEIDTKYLKEKNVAALLETLAAEIVIQRPNDPEAFLRDRFSDGKEDTFKPSDAITLYVT
MLSPVSAVALLALSYAKHNNQITGYDVSEINDGTPIPSDFHSTSPFQRLPALNHNGVGVV
EAGAIAKYVCSRTSAFPVTPARQRARVDSLFETIQHLVLSEATAAVEERVFAPRKHQRPA
DNISVQASATRFRAALSQLQSAAHLFEDSVWVVGSAVSIADIILAAAVFSMHHVAGFDCV
SGLEKLSKWWAAVQQEVFFVEGIRPLQAAAAKLYSR
Download sequence
Identical sequences A0A0S4IKZ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]