SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S4JWF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S4JWF1
Domain Number 1 Region: 78-241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.06e-34
Family G proteins 0.00038
Further Details:      
 
Domain Number 2 Region: 13-55
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000249
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S4JWF1
Sequence length 283
Comment (tr|A0A0S4JWF1|A0A0S4JWF1_BODSA) ADP-ribosylation factor-like protein, putative {ECO:0000313|EMBL:CUG94375.1} KW=Complete proteome; Reference proteome OX=75058 OS=Bodo saltans (Flagellated protozoan). GN=BSAL_47870 OC=Eukaryota; Euglenozoa; Kinetoplastida; Bodonidae; Bodo.
Sequence
MSTISNSEAEARTQYCKTKNVHHLFELLATKVLLDKPENVYQYLRELLTKVEESEKKDHT
HDPTQIQRNDGTKGLLKMTVAIFGIDNAGKTALLSAMGGQVDAETQPTVGFSPTQFQTDK
YDICIFDLGGAKNFRGIWTHYFHDCHAVIYVVDASDTERLGESAQVFQSVVGHKFMEGKP
ILVFANKKDKVPAGQSAESIAEVALSLKSVVPSTTPLRVIGTCAIQEDSSVEAGVEWIFG
SVENRYGDLSGRVKKDMAEIQEEKKRKQQARLEALRKQQEEGK
Download sequence
Identical sequences A0A0S4JWF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]