SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7G746 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7G746
Domain Number 1 Region: 23-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.06e-41
Family CRAL/TRIO domain 0.0025
Further Details:      
 
Domain Number 2 Region: 256-382
Classification Level Classification E-value
Superfamily PapD-like 1.02e-33
Family MSP-like 0.00000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S7G746
Sequence length 430
Comment (tr|A0A0S7G746|A0A0S7G746_9TELE) MSPD2 {ECO:0000313|EMBL:JAO25009.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=MSPD2 OC=Poeciliinae; Poeciliopsis.
Sequence
MIDESLLWRKEFGINDVSESTIPRWMFESGAVFLHGYDREGNKLFWFKVKLHTKDAKTVV
DKKKYVAFWLERYAKKEPGMPLTVVFDMTESGLSNIDMDFVKYVINCFKVYYPKFLSKMI
IVDMPWIMNAAWKIVKSWLGPEAIAKLKFATKTEIHTYIGAEYLPPHLGGSDLFKYTYPP
LPDDDFQTPLCENGPMASEDDAESKEGEMESRDTLESSFNSEIVAKPKKVNFLEESLRSE
DGDKDTNVRVKGVRKPLTTFKGLLLDVSPSEELSFGSGENEKKCLIILSNVTKNQVAFKV
RTTAPEKYRVKPSSSSCEPGASVDIVVSLHGGSQASPQDRFLIMAAEMENAGSQELTQFW
KEVQKNKIMEHRLRCHVLDSVKSSGVPHRDSLGETSTNGQQELSTAVSSDARIFKMSPLC
HYACIARLKA
Download sequence
Identical sequences A0A0S7G746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]