SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7KCS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7KCS8
Domain Number 1 Region: 255-375
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.89e-29
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 44-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-24
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 3 Region: 154-252
Classification Level Classification E-value
Superfamily LCCL domain 4.32e-23
Family LCCL domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S7KCS8
Sequence length 379
Comment (tr|A0A0S7KCS8|A0A0S7KCS8_9TELE) DCBD2 {ECO:0000313|EMBL:JAO75228.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=DCBD2 OC=Poeciliinae; Poeciliopsis.
Sequence
MGRAVMVGRGPTGAGVLVLSVLIVLTAEGCRGQKGDGCGPSVLGPSSGTLSSLDNLRTYP
SDTVCEWEITVPRGKRIHFRFALLDLGDSDCQVNYLRLYNGIGSKKTEIVKYCGLDQKVD
ELIESSGNQVTVQFRSVMHRSGRGFYLSYSTTEHSDLITCLNKGSDFPEAEFSKYCPAGC
LTSTEKISGTTPNGYRESSPLCVAAIHAGAVSNAAGGKITVVSSTGIPHYEATLANNVTS
TVGILSKNLFTFKTDGCSGTLGLESGGVLDSQLSVSSVWDWNSTAGEHVVWGKSGARLKK
PGLPWAPSPSDRQQWLQVDFRREKRITAIVTTGSDRSEYQYFVKAYRVLFSKDGKEWHFY
RETNSSQDKIFQGNEKIRL
Download sequence
Identical sequences A0A0S7KCS8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]