SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U0FYW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U0FYW9
Domain Number 1 Region: 152-439
Classification Level Classification E-value
Superfamily CAC2185-like 8.89e-93
Family CAC2185-like 0.0000571
Further Details:      
 
Domain Number 2 Region: 3-176
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000000000889
Family Spore coat polysaccharide biosynthesis protein SpsA 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0U0FYW9
Sequence length 440
Comment (tr|A0A0U0FYW9|A0A0U0FYW9_STREE) Capsular polysaccharide biosynthesis protein {ECO:0000313|EMBL:COE79572.1} OX=1313 OS=Streptococcus pneumoniae. GN=ERS020522_01904 OC=Streptococcus.
Sequence
MERQTLKDIEVIIVNQSTEEIASISQQMNLSFNIKIIDENSFAELSDMITGDYITFLSSN
DSLFDWTFEKMYHAIKLSDSDVVLGHFADLVDGVFYFYPFLGGDNWLTENLTNVQVLQKM
DDTDHRIRKQYRSLFGKLFNSKLLRKINQFDINNLIWRLYIHSKTATYINFPTYIYKPVI
DAKPLKDSYKIILENYENRIKDCAVLENYDIERAKKQYIQELANFSAWLKNDGEYLDSDI
VYHKLIAAEKGIFPFLELDRLDFTIISNNCVGGLIYKQLGFQYRTPFVGLFILSDDYYKL
TKHFRYYMEQELVFEEELISPSWTHEVYPLGHLGDIDIHFLHYSSIEEARTKWEKRKKRI
NWNNLYFKFDNKDSASEEILNKMDNLPYSNKLILVNRPYKNLKSQCVIPGQEHLPELAIM
SDPLNTFDIMAWLKKGGNAL
Download sequence
Identical sequences A0A0U0FYW9
WP_078149902.1.19162 WP_078149902.1.36762 WP_078149902.1.38024 WP_078149902.1.45433 WP_078149902.1.52515 WP_078149902.1.76667 WP_078149902.1.76892 WP_078149902.1.97879 WP_078149902.1.99554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]