SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U2IC71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0U2IC71
Domain Number - Region: 106-125,164-182,220-316
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00353
Family Pseudo ankyrin repeat 0.05
Further Details:      
 
Domain Number - Region: 438-566
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 0.0118
Family Class I alpha-1;2-mannosidase, catalytic domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U2IC71
Sequence length 632
Comment (tr|A0A0U2IC71|A0A0U2IC71_9VIRU) Uncharacterized protein {ECO:0000313|EMBL:ALR84388.1} OX=1766765 OS=Niemeyer virus. GN= OC=unclassified Mimiviridae.
Sequence
MMSQTFFLISDPDNLDYPIYTVHDKSRILDCFCDISLFKTTTITEIELDNEHPDFKILKL
YGNTFMTNRIIKNTKYSLLDVNTVQMLLDYGDPDYEFKSTHYLYVFYMSQNRFDICDYLI
ASNIKFVGTYTKSCLLNQNTLTNYHLFKYIINNSEFFGCCHYDLMYAAFRYTKFYDLCDH
LIKSEYNCNIDYDNFLRQLFNKTDSNGFTINCELDTFQIKKLIDENYFDNEKLFYTVLYD
SFELTKYIVEKGFYYDFDSVINSDINLEMLKFFIELGNNLTDDHIMILLSKKYSNDYCKK
ITFLLDNNYITEKHFTNKIVSDIVWFDLNLLDYLINKLNIIELINLDILMKTSILRENIN
MIKKCIEYGINVDDYMKFAVDYSICITKKLIELGGNIPDDICIYNPYHSLSIESIDIILE
NNYDSLENLLLKIINQNKETLYIDEILHIMGKLISTNKPIPDLNKILIKSCYYSDNIYKE
IIKLDLNLDNYQQIFVNIMRKEYDNIEQLIFFSTYYNSIELLFVVVLSENIDLFKLLLEI
NCNDTDYLSWAFVFSGRCFKLMKYIVDNYNVDIYQRQIEVCIMIPKKDYQTKRYLQLMGY
EISCIYNTECNNDKLPLVEFMKELSIDSTIRP
Download sequence
Identical sequences A0A0G2Y9Y2 A0A0U2IC71 A0A140E166 E3W077 G8EBM2 Q5UPQ6
YP_003987297.1.55212 gi|311978177|ref|YP_003987297.1| YL767_MIMIV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]