SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U5J867 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U5J867
Domain Number 1 Region: 99-256
Classification Level Classification E-value
Superfamily TNF-like 1.13e-38
Family TNF-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0U5J867
Sequence length 256
Comment (tr|A0A0U5J867|A0A0U5J867_DASNO) Tumor necrosis factor ligand 1B {ECO:0000313|EMBL:CTQ86266.1} OX=9361 OS=Dasypus novemcinctus (Nine-banded armadillo). GN=TNLG1B OC=Mammalia; Eutheria; Xenarthra; Cingulata; Dasypodidae; Dasypus.
Sequence
MVGDLGLDFGESASMEMLPEEGIHRPKARGALEARSGSLLWALTCCMVALPLLTGLTTYV
LVGQLRVQGEACLFKTPKGQEFGPSPQQAYAPPRTDGDKPRAHLTVVRQTSTQHLKNQFP
ALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQITFRGTASECGKINQQSQLNKPD
SIIVIVTKVTDSYPLPTQLLTGTKSVCEIGTNWFQPIYLGAVFSLQEGDKLVVNVSDISL
VDYTKEDKTFFGAFLL
Download sequence
Identical sequences A0A0U5J867
XP_004463222.1.11602 ENSDNOP00000030477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]