SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0IF47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0IF47
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.2e-39
Family PAPS reductase-like 0.0035
Further Details:      
 
Domain Number 2 Region: 245-354
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.65e-22
Family PDI-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V0IF47
Sequence length 357
Comment (tr|A0A0V0IF47|A0A0V0IF47_SOLCH) Putative 5'-adenylylsulfate reductase 1, chloroplastic-like {ECO:0000313|EMBL:JAP30903.1} OX=4108 OS=Solanum chacoense (Chaco potato). GN= OC=Solaneae; Solanum.
Sequence
MDKALEKFGDDIAIAFSGAEDVALIEYAHLTGRPYRVFSLDTGRLNPETYQLFDTVEKHY
GIRIEYMFPDSVEVQALVRTKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKD
QSPGTRSEIPIVQVDPSFEGLDGGAGSLVKWNPVANVDGKDIWNFLRAMNVPVNSLHSQG
YVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKDESVDGAVQTNGTATIAD
IFDTKDIVTLSKPGVENLLKLEDRREPWLVVLYAPWCQFCQAMEGSYVELAEKLAGSGVK
VGKFRADGDQKAFAQQELQLGSFPTILFFPKHSSKAIKYPSEKRDVDSLLAFVNALR
Download sequence
Identical sequences A0A0V0IF47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]